Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

111 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4B6Y3_BMF-01      --------------------------------------------------
F6TGJ4_BMF-01          --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
I3MDS9_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-04      --------------------------------------------------
A0A287AIU8_BMF-03      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q8K589_BMF-01          --------------------------------------------------
I3MDS9_BMF-01          MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP------------
G3T7Z4_BMF-01          MPRAGVFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPPLPAELFPSFPI
F6X3N6_BMF-01          --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
F6TJI0_BMF-02          --------------------------------------------------
F6TJI0_BMF-01          --------------------------------------------------
A0A286XXB0_BMF-02      ----------------------------------MPGAGVFWKQYRARRR
J9PB65_BMF-01          --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
M3WRS0_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A2K5MJY6_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-02      --------------------------------------------------
G7PAW6_BMF-02          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5G4_BMF-04      --------------------------------------------------
A0A2K6B5G4_BMF-02      --------------------------------------------------
A0A2K6B5G4_BMF-01      --------------------------------------------------
A0A2K5Z4C3_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
F7HPK0_BMF-01          --------------------------------------------------
A0A2K5E1W9_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-02      --------------------------------------------------
A0A2K6TW86_BMF-01      --------------------------------------------------
G3QIN5_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A9XRG9_BMF-02          --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A9XRG9_BMF-03          --------------------------------------------------
A9XRG9_BMF-04          --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5UAU7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-04      --------------------------------------------------
A0A3B3I0V9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-02      --------------------------------------------------
A0A3B3I0V9_BMF-03      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A3B4B6Y3_BMF-01      ------------------------------------------MED-----
F6TGJ4_BMF-01          ------------------------------------QESYLNMDE-----
G1PAU1_BMF-01          ------------------------------------MEPPQCVEE-----
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEE-----
A0A286XXB0_BMF-03      -------------------------------VFPREMEPPQCVEE-----
I3MDS9_BMF-02          -------------------------------VFPEEMEPPQCVEE-----
A0A287AIU8_BMF-05      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-01      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-04      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-03      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-02      ------------------------------------MEPPQCVEE-----
A0A2K5KGR6_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6FFR1_BMF-02      ------------------------------------MEPSHCVEE-----
M3WRS0_BMF-02          ------------------------------------MEPPQCVEE-----
A0A2K5E1W9_BMF-02      ------------------------------------MEPSQCVEE-----
F7HPK0_BMF-02          ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-03      ------------------------------------MEPSQCVEE-----
A0A2K6RAW8_BMF-02      ------------------------------------MEPSRCVEE-----
G3QIN5_BMF-02          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-07          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-05          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K5MJY6_BMF-01      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-01          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2I3HD83_BMF-01      ------------------------------------MEPSQCVEE-----
A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEE-----
Q8K589_BMF-01          ------------------------------------MEPPQCVEE-----
I3MDS9_BMF-01          GSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEE-----
G3T7Z4_BMF-01          ESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEE-----
F6X3N6_BMF-01          ------------------------------------MEPPHYVEE-----
G3WDQ2_BMF-01          ------------------------------------MESPHYVEE-----
Q96LC9_BMF-06          ------------------------------------MEPSQCVEE-----
F6TJI0_BMF-02          ------------------------------------MEPPQCVEE-----
F6TJI0_BMF-01          ------------------------------------MEPPQCVEE-----
A0A286XXB0_BMF-02      RRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEE-----
J9PB65_BMF-01          ------------------------------------MEPPQCVEE-----
A0A286XXB0_BMF-01      ------------------------------------MEPPQCVEE-----
G1SR62_BMF-01          ------------------------------------MEPPQCVEE-----
Q05KI3_BMF-02          ------------------------------------MEPPQCVEE-----
Q05KI3_BMF-01          ------------------------------------MEPPQCVEE-----
W5QFV1_BMF-01          --------------------------------LTGEMEPPQCVEE-----
M3WRS0_BMF-01          ------------------------------------MEPPQCVEE-----
M3YAD5_BMF-01          ------------------------------------MEPPQCVEE-----
A0A2U4BC98_BMF-01      ------------------------------------MEPPQCVEE-----
A0A2K6FFR1_BMF-01      ------------------------------------MEPSHCVEE-----
H0WYH6_BMF-01          ------------------------------------MEPSQCVEE-----
A0A096NTE9_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5MJY6_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5KGR6_BMF-02      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-02          ------------------------------------MEPSRCVEE-----
F7CM09_BMF-02          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-04      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K6RAW8_BMF-01      ------------------------------------MEPSRCVEE-----
A0A0D9R4R5_BMF-01      ------------------------------------MEPSRCVEE-----
F7HPK0_BMF-01          ------------------------------------MEPSQCVEE-----
A0A2K5E1W9_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-01      ------------------------------------MEPSQCVEE-----
G3QIN5_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-02          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-04          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-03          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8T301_BMF-01      ------------------------------------MEPSQCVEE-----
H9GL49_BMF-01          ------------------------------------MDPPGYLDDDFSTL
K7FRX2_BMF-01          ------------------------------------MDPPSYLEEDYSSL
A9XRG9_BMF-02          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-01          ------------------------------------MDRPSYLEEDYSSL
U3JS06_BMF-01          ------------------------------------MDRPSYLEEDYSSL
H0ZMX5_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-03          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-04          ------------------------------------MDRPSYLEEDYSSL
G1NHG8_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A0A3B4UNJ0_BMF-01      ------------------------------------------MDD-----
Q0GKC7_BMF-01          ------------------------------------------MDE-----
W5N4P7_BMF-01          ------------------------------------------MEE-----
A0A3B3RH63_BMF-01      ------------------------------------------MDD-----
W5UAU7_BMF-01          ------------------------------------------MDE-----
A0A3B1K1X5_BMF-01      ------------------------------------------MDD-----
A0A3B4CNJ8_BMF-01      ------------------------------------------MDE-----
A0A2U9CJH3_BMF-01      ------------------------------------------MDD-----
A0A3B5KWG6_BMF-01      ------------------------------------------MDD-----
A0A3B3CGR9_BMF-01      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-04      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-01      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-02      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-03      ------------------------------------------MDD-----
A0A3B4U5H8_BMF-01      ------------------------------------------MDD-----
A0A3B4WM88_BMF-01      ------------------------------------------MDD-----
I3K2D6_BMF-01          ------------------------------------------MDD-----
A0A3B4ETH0_BMF-01      ------------------------------------------MDD-----
A0A3B5B8F6_BMF-01      ------------------------------------------MDD-----
A0A096LRV0_BMF-01      ------------------------------------------MED-----
A0A3B3WU80_BMF-01      ------------------------------------------MED-----
A0A3B5QK08_BMF-02      ------------------------------------------MED-----
A0A3B5QK08_BMF-01      ------------------------------------------MED-----
A9XRH0_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A3KND0_BMF-01          -------------------------------------------------M
                                                                         

A0A3B4B6Y3_BMF-01      --EEDDVFEPD-----------------------------------LHCW
F6TGJ4_BMF-01          --LDDDVFYPD--EFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCC
G1PAU1_BMF-01          --LEDDVFQPED-ELGTQPGSLPSADLFAQSQ-LDCPLSRLQLFPLTHCC
A2AV74_BMF-02          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A286XXB0_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
I3MDS9_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-05      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-01      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-04      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-03      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-02      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A2K5KGR6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6FFR1_BMF-02      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-02          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
A0A2K5E1W9_BMF-02      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-07          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-05          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-01          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2I3HD83_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A2AV74_BMF-01          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
Q8K589_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
I3MDS9_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
G3T7Z4_BMF-01          --LEDDVFQPEEGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
F6X3N6_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSAALFAQSQ-PDYMLDGLQLFPLTHCC
G3WDQ2_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSPALFAQSQ-PDYMLDGLQLFPLTHCC
Q96LC9_BMF-06          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
F6TJI0_BMF-02          --LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLRLFPLTHCC
F6TJI0_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLRLFPLTHCC
A0A286XXB0_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
J9PB65_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A286XXB0_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
G1SR62_BMF-01          --LEDDVFQPEDGEPGTQPQSLLSADPFAQSQ-LDCPLGRLHLFPLTHCC
Q05KI3_BMF-02          --LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
Q05KI3_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
W5QFV1_BMF-01          --LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-01          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
M3YAD5_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A2U4BC98_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A2K6FFR1_BMF-01      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
H0WYH6_BMF-01          --LEDDVFQPEDGELGT--GNVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5KGR6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-02          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7CM09_BMF-02          --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-04      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A0D9R4R5_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5E1W9_BMF-01      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-04          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-03          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8T301_BMF-01      --LEDDVFQPEDGEPGTQSGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
H9GL49_BMF-01          DGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCC
K7FRX2_BMF-01          DGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-02          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
U3JS06_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
H0ZMX5_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-03          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-04          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
G1NHG8_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A0A3B4UNJ0_BMF-01      --EEEDMSQPI-----------------------------------SHLW
Q0GKC7_BMF-01          --DEDDVFRKG-----------------------------------LQHW
W5N4P7_BMF-01          --DEDDVFHPSH---------------------------------FSHCW
A0A3B3RH63_BMF-01      --DDDDVFHTD-----------------------------------PLTY
W5UAU7_BMF-01          --DEDEVFGPI-----------------------------------SQCW
A0A3B1K1X5_BMF-01      --EEDDVFVTD-----------------------------------PEPW
A0A3B4CNJ8_BMF-01      --DEDDVFVMD-----------------------------------TQYW
A0A2U9CJH3_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3B5KWG6_BMF-01      --EEDDVFQPD-----------------------------------PYSW
A0A3B3CGR9_BMF-01      --EEDDVFEPD-----------------------------------PNNW
A0A3B3I0V9_BMF-04      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-01      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-02      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-03      --EEDDVFEPD-----------------------------------PNKW
A0A3B4U5H8_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3B4WM88_BMF-01      --EEDDVFEPD-----------------------------------PHCW
I3K2D6_BMF-01          --EEDDVFEPK-----------------------------------ANCW
A0A3B4ETH0_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3B5B8F6_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A096LRV0_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3B3WU80_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3B5QK08_BMF-02      --EEDDVFEPD-----------------------------------PNCW
A0A3B5QK08_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A9XRH0_BMF-01          DGLDDDVFHSD--DFGLAGNA-----------GY-----RLHVPPVGFAL
A3KND0_BMF-01          DELDDDVFYPD--AFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCC
                          ::::                                           

A0A3B4B6Y3_BMF-01      HTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFY---------
F6TGJ4_BMF-01          GPGCRGADYEDKATQTLGSPSISQDIMLPCGVSETPQRLFYGHAGYLLYL
G1PAU1_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A2AV74_BMF-02          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-03      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
I3MDS9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-05      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-04      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5KGR6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K6FFR1_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSHV
M3WRS0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAKPPSSV
A0A2K5E1W9_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYASAEPKSRV
F7HPK0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSHV
A0A2K6TW86_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2K6RAW8_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
G3QIN5_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
Q96LC9_BMF-07          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
Q96LC9_BMF-05          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2R9BS98_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2J8QDD5_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2K5MJY6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
G7PAW6_BMF-01          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K6B5G4_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K5Z4C3_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A096NTE9_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2I3HD83_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A2AV74_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q8K589_BMF-01          GPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
I3MDS9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G3T7Z4_BMF-01          GPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6X3N6_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPL
G3WDQ2_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPL
Q96LC9_BMF-06          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6TJI0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6TJI0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-02      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
J9PB65_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-01      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G1SR62_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q05KI3_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPL
Q05KI3_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPL
W5QFV1_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
M3WRS0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
M3YAD5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2U4BC98_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6FFR1_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
H0WYH6_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNVGYRLPL
A0A096NTE9_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A096NTE9_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5MJY6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5KGR6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G7PAW6_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F7CM09_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-04      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5Z4C3_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6RAW8_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A0D9R4R5_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F7HPK0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5E1W9_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6TW86_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6TW86_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G3QIN5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-04          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-03          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2R9BS98_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2J8QDD5_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2J8T301_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
H9GL49_BMF-01          GPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHV
K7FRX2_BMF-01          GPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHE
A9XRG9_BMF-02          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A9XRG9_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
U3JS06_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHV
H0ZMX5_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHV
A9XRG9_BMF-03          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A9XRG9_BMF-04          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
G1NHG8_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A0A3B4UNJ0_BMF-01      GTSFRDVKYEDRATPIAA-------GQALTAVTAAPLILF-------VWW
Q0GKC7_BMF-01          PPPHLQIK----QTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLA
W5N4P7_BMF-01          GTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNAAFRLHF
A0A3B3RH63_BMF-01      QPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYGSAGLRLHF
W5UAU7_BMF-01          PSSNREIKQEDHSTQTPGSPAVRLNGMLPCGVAEEPRRLFYGSAGLLLLT
A0A3B1K1X5_BMF-01      RSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLA
A0A3B4CNJ8_BMF-01      RSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLA
A0A2U9CJH3_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B5KWG6_BMF-01      RTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGEAGDTLHY
A0A3B3CGR9_BMF-01      RTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-04      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-01      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-02      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-03      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B4U5H8_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHF
A0A3B4WM88_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHF
I3K2D6_BMF-01          RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B4ETH0_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B5B8F6_BMF-01      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A096LRV0_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHF
A0A3B3WU80_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHF
A0A3B5QK08_BMF-02      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHF
A0A3B5QK08_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHF
A9XRH0_BMF-01          DPNLQ-EEPQEGQREART--EVQIARKLQC-IADQFHRLHI---------
A3KND0_BMF-01          GPGCRGTDNEDKATQTLG--SPSQDIMLPCGVSETPQRLFY---------
                        .                                    :           

A0A3B4B6Y3_BMF-01      --AHFELGEDQEASESLQEGEMQNGREPLPRHPVA-VRSMEACIGHKLQL
F6TGJ4_BMF-01          -PQNSPA--RFGEEVDN---------------RRQ-EQSAEHRIARKLQC
G1PAU1_BMF-01          -PASFPAGSPLGEQPPE---------------GQWQHHRAEIQIARKLQS
A2AV74_BMF-02          -PASFPAGSPLGEQPPE---------------GQFLQHRAEVQIARKLQC
A0A286XXB0_BMF-03      -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
I3MDS9_BMF-02          -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A287AIU8_BMF-05      -PAGFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A287AIU8_BMF-01      -PAGFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A287AIU8_BMF-04      -PAGFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A287AIU8_BMF-03      -PAGFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A287AIU8_BMF-02      -PAGFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K5KGR6_BMF-01      -VADPPL-------PAQ---------------PCF-EWRREQERGGPQVR
A0A2K6FFR1_BMF-02      -VADPPL-------PTQ---------------PCF-ERRREQERGRSQ--
M3WRS0_BMF-02          -VADSPL-------PTQ---------------PGF-ECRREQEWGRSQ--
A0A2K5E1W9_BMF-02      -VAGPPL-------SAQ---------------PGF-EWRREQEWGRPE--
F7HPK0_BMF-02          -VAGPPL-------PAQ---------------PGF-EWRREQEWGRPE--
A0A2K6TW86_BMF-03      -VAGPPL-------PAQ---------------PGF-EWRRKQEWGRSE--
A0A2K6RAW8_BMF-02      -VADPPL-------PAQ---------------PCF-EWRRE---------
G3QIN5_BMF-02          -VADPPL-------PAQ---------------PCF-EWRREQERGRP---
Q96LC9_BMF-07          -VADPPL-------PAQ---------------PCF-EWRREQERGRP---
Q96LC9_BMF-05          -VADPPL-------PAQ---------------PCF-EWRREQERGRP---
A0A2R9BS98_BMF-02      -VADPPL-------PAQ---------------PCF-EWRREQERGRP---
A0A2J8QDD5_BMF-01      -VADPPL-------PAQ---------------PCF-EWRREQERGRP---
A0A2K5MJY6_BMF-01      -VADPPL-------PAQ---------------PCF-EWRREQERGGP---
G7PAW6_BMF-01          -VADPPL-------PAQ---------------PCF-EWRREQERGGP---
A0A2K6B5G4_BMF-03      -VADPPL-------PAQ---------------PCF-EWRREQERGGP---
A0A2K5Z4C3_BMF-02      -VADPPL-------PAQ---------------PCF-EWRREQERGGP---
A0A096NTE9_BMF-03      -VADPPL-------PAQ---------------PCF-EWRREQERGGP---
A0A2I3HD83_BMF-01      -VADPPL-------PAQ---------------PCF-EWRREQEWGRP---
A2AV74_BMF-01          -PASFPAGSPLGEQPPE---------------GQFLQHRAEVQIARKLQC
Q8K589_BMF-01          -PASFPAGSALGEQPPE---------------GQFLQHRAEVQIARKLQC
I3MDS9_BMF-01          -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
G3T7Z4_BMF-01          -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
F6X3N6_BMF-01          -PASFPASLRLGEEPPE---------------EQW-EHRAEVQIAQKLQC
G3WDQ2_BMF-01          -PANFPSSLRLGAEPPE---------------EQW-EHRAEVQIARKLQC
Q96LC9_BMF-06          -PASFPAVLPIGEQPPE---------------GQW-QHQAE---------
F6TJI0_BMF-02          -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
F6TJI0_BMF-01          -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A286XXB0_BMF-02      -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
J9PB65_BMF-01          -PASFPAGLPLLEQPPE---------------GQW-QHRAEVQIARKLQC
A0A286XXB0_BMF-01      -PASFPAGLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
G1SR62_BMF-01          -PASFPANFALGEQPPE---------------GQW-QHRAEVQIARKLQC
Q05KI3_BMF-02          -PASFPAGLPLGEQPPE---------------GQW-QHRAEIQIARKLQC
Q05KI3_BMF-01          -PASFPAGLPLGEQPPE---------------GQW-QHRAEIQIARKLQC
W5QFV1_BMF-01          -PASFPAGLPLGEQPPE---------------GQW-QHRAEIQIARKLQC
M3WRS0_BMF-01          -PASFPAGLPLGEQPPE---------------GHW-QHRAEVQIARKLQC
M3YAD5_BMF-01          -PASFPAGLPLGDQPPE---------------GQW-QHRAEVQIARKLQC
A0A2U4BC98_BMF-01      -PAGFPAGLPLGEQPAE---------------GQW-QHRAEVQIARKLQR
A0A2K6FFR1_BMF-01      -PASFPAGLPLGEQPAE---------------GQW-QHRAEVQIARKLQC
H0WYH6_BMF-01          -PASFPAGLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A096NTE9_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6L933_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A096NTE9_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K5MJY6_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K5KGR6_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
G7PAW6_BMF-02          -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
F7CM09_BMF-02          -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6B5G4_BMF-04      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6B5G4_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6B5G4_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K5Z4C3_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6L933_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6L933_BMF-03      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6RAW8_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A0D9R4R5_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
F7HPK0_BMF-01          -PASFPAVLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K5E1W9_BMF-01      -PASFPAVLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6TW86_BMF-02      -PASFPAVLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2K6TW86_BMF-01      -PASFPAVLPLGEQPPE---------------GQW-QHRAEVQIARKLQC
G3QIN5_BMF-01          -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
Q96LC9_BMF-02          -PASFPAVLPIGEQPPE---------------GQW-QHQAEVQIARKLQC
Q96LC9_BMF-01          -PASFPAVLPIGEQPPE---------------GQW-QHQAEVQIARKLQC
Q96LC9_BMF-04          -PASFPAVLPIGEQPPE---------------GQW-QHQAEVQIARKLQC
Q96LC9_BMF-03          -PASFPAVLPIGEQPPE---------------GQW-QHQAEVQIARKLQC
A0A2R9BS98_BMF-01      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2J8QDD5_BMF-02      -PASFPAVLPIGEQPPE---------------GQW-QHRAEVQIARKLQC
A0A2J8T301_BMF-01      -PASFPAVLPTGEQPPE---------------GQW-QHRAEVQIARKLQC
H9GL49_BMF-01          SPIGFSLNPHFQEEPQE---------------SPQ-ELRTEVQIARKLQC
K7FRX2_BMF-01          PPVGFALNPHLQEEPRE---------------GHQ-EARAEVQIARKLQC
A9XRG9_BMF-02          PPVGFALDPNLQEEPQE---------------GQR-EARTEVQIARKLQC
A9XRG9_BMF-01          PPVGFALDPNLQEEPQE---------------GQR-EARTEVQIARKLQC
U3JS06_BMF-01          PPAGFVLDPHLQEEPQE---------------GQR-EARAEVQIARKLQC
H0ZMX5_BMF-01          PPAGFVLDPHLQEEPQE---------------GQR-EARAEVQIARKLQC
A9XRG9_BMF-03          PPVGFALDPNLQEEPQE---------------GQR-EARTEVQIARKLQC
A9XRG9_BMF-04          PPVGFALDPNLQEEPQE---------------GQR-EARTEVQIARKLQC
G1NHG8_BMF-01          PPVGFALDPNLQEEPQE---------------GQR-EARTEVQIARKLQC
A0A3B4UNJ0_BMF-01      -VPHWELSPSTKMNMLRFSENRP---------EEQAGVSVEAQIGRKLRE
Q0GKC7_BMF-01          -AS---------SRAQPPDVVLRQNVSPMERPEPRPAQSVETLIGQKLQL
W5N4P7_BMF-01          -PAHFEQGGDEEEETGEA--------------EEQPVRSAEVRIGQKLQR
A0A3B3RH63_BMF-01      -PALSVPGGHPPQEERQ------------PD-DRP-QPSAEVRIGQKLQM
W5UAU7_BMF-01          -PS-------ARTNRVEDAMFPENR----PR-RRP-AHSVEAQIGQKLQM
A0A3B1K1X5_BMF-01      -PS-------ARSERVGDAMFREEHRAVEPR-RRP-AHSVEARIGQKLQM
A0A3B4CNJ8_BMF-01      -PS-------VRPEHVEGAMLQEDQLAMEPR-RRP-PHSVEARIGQKLQM
A0A2U9CJH3_BMF-01      -PAHFELFGDQEVRGHE-SEEERSGMEQLPRQQQPVAHSVEACIGQKLQL
A0A3B5KWG6_BMF-01      ------------------TGGAPNGMEPLPQ-QGPVVRSTEACIGQKLQL
A0A3B3CGR9_BMF-01      -PARFELAGDLEARRHD-REAERGGMERLPR-QQPAARSTEACIAQKLQL
A0A3B3I0V9_BMF-04      -PARFELAGDLEVRRHD-REAERRGMERLPR-QQPVARSTEACIAQKLQL
A0A3B3I0V9_BMF-01      -PARFELAGDLEVRRHD-REAERRGMERLPR-QQPVARSTEACIAQKLQL
A0A3B3I0V9_BMF-02      -PARFELAGDLEVRRHD-REAERRGMERLPR-QQPVARSTEACIAQKLQL
A0A3B3I0V9_BMF-03      -PARFELAGDLEVRRHD-REAERRGMERLPR-QQPVARSTEACIAQKLQL
A0A3B4U5H8_BMF-01      -PAHFELVGDQEARRQG-SGEERNGMEQLPR-QQPVARSVEACIGQKLQL
A0A3B4WM88_BMF-01      -PAHFELVGDQEARRQG-SGEERNGMEQLPR-QQPVARSVEACIGQKLQL
I3K2D6_BMF-01          -PARFELVGDHRARRQE-IAEQQNSMERLPR-QRPAARSVEACIGQKLQL
A0A3B4ETH0_BMF-01      -PARFELVGDHRASRQG-STEQQNSMERLPR-QRPAARSVEACIGQKLQL
A0A3B5B8F6_BMF-01      -PARFELIGDHQARQQQGSEMEQNGMEQLPR-QQPVARSVEACIGQKLQL
A0A096LRV0_BMF-01      -PAHFELVGDFDARQQE----EQNRMEQLPL-HQPAALSLEACIGQKLQL
A0A3B3WU80_BMF-01      -PAHFELVGDFDARQQE----EQNRMEQLPL-HQPAALSLEACIGQKLQL
A0A3B5QK08_BMF-02      -PAHFELVGDFDARQQE----EQNRMEQLPL-HQPAALSLEASIGQKLQL
A0A3B5QK08_BMF-01      -PAHFELVGDFDARQQE----EQNRMEQLPL-HQPAALSLEASIGQKLQL
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A3B4B6Y3_BMF-01      IGDQFHRDHLQRVREH----------------------------------
F6TGJ4_BMF-01          IGDQFHRFHL---QRLQQNRNQFWSQILIFF------RNLVMHPVGNRAG
G1PAU1_BMF-01          IADQFHRLQM---QQHQQNRNRMWWQFLLFL------HNLALNGDENRNG
A2AV74_BMF-02          IADQFHRLHT---QQHQQNRDRAWWQVFLFL------QNLALNRQENREG
A0A286XXB0_BMF-03      IADQFHRLHI---QQHQQNRNRAWWQVLLFM------HNLGLNGEENREG
I3MDS9_BMF-02          IADQFHRLHM---QQHQQNRNRVWWQILLFL------HNLALNGDENRDR
A0A287AIU8_BMF-05      IADQFHRLHM---QQEFPS----WLG------------------------
A0A287AIU8_BMF-01      IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALHGDENRNG
A0A287AIU8_BMF-04      IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALHGDENRNG
A0A287AIU8_BMF-03      IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALHGDENRNG
A0A287AIU8_BMF-02      IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALHGDENRNG
A0A2K5KGR6_BMF-01      LGCPLHMGHQ---EHRQEGHRAGLTLCLVKL------FFCCYFAF-----
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          IADQFHRLHT---QQHQQNRDRAWWQVFLFL------QNLALNRQENREG
Q8K589_BMF-01          IADQFHRLHM---QQHQQNRDRAWRQVFLFL------QNLALNRRENREG
I3MDS9_BMF-01          IADQFHRLHM---QQHQQNRNRVWWQILLFL------HNLALNGDENRDR
G3T7Z4_BMF-01          IADHFHRLHM---QRHQQNRNPAWRQILQFL------HHLAVNGEENRNG
F6X3N6_BMF-01          IADQFHRLHM---QRHQQNRNHVWWQILLFL------HNLALNREENRNG
G3WDQ2_BMF-01          IADQFHRLHM---QRHQQNQNHVWWQILLFL------HNLALNREENRNG
Q96LC9_BMF-06          ---------------HQQNQNRVWWQILLFL------HNLALNGEENRNG
F6TJI0_BMF-02          IADQFHRLHM---QQHQQNRNRVWWQTLLFL------HNLALNGDENRNG
F6TJI0_BMF-01          IADQFHRLHM---QQHQQNRNRVWWQTLLFL------HNLALNGDENRNG
A0A286XXB0_BMF-02      IADQFHRLHI---QQHQQNRNRAWWQVLLFM------HNLGLNGEENREG
J9PB65_BMF-01          IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALNADENRNG
A0A286XXB0_BMF-01      IADQFHRLHI---QQHQQNRNRAWWQVLLFM------HNLGLNGEENREG
G1SR62_BMF-01          IADQFHRLHL---QQHQQNRNRVWWQILLFL------HNLALNGDENRDG
Q05KI3_BMF-02          IADQFHRLHM---QQYQQNRNRMWWQILLFL------HNVALNGDENRNG
Q05KI3_BMF-01          IADQFHRLHM---QQYQQNRNRMWWQILLFL------HNVALNGDENRNG
W5QFV1_BMF-01          IADQFHRLHM---QQHQQNRNRMWWQILLFL------HNVALNGDENRNG
M3WRS0_BMF-01          IADQFHRLHM---QQHQQNRRRVWWQILLFL------HNLALNAEENRNG
M3YAD5_BMF-01          IADQFHRLHM---QQHQQNQNRVWWQILLFL------HNLALNADENRNG
A0A2U4BC98_BMF-01      IADQFHRLHM---QQHQQNRNRVWWQILLFL------HNLALNGDENRNG
A0A2K6FFR1_BMF-01      IADQFHRLHV---QQHQQNQNRMWWQILLFL------HNLALNGEENRNG
H0WYH6_BMF-01          IADQFHRLHV---QQHQQNQNRVWWQVLFFL------HNLALNGEENRNG
A0A096NTE9_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6L933_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A096NTE9_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K5MJY6_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K5KGR6_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
G7PAW6_BMF-02          IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
F7CM09_BMF-02          IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEQNRNG
A0A2K6B5G4_BMF-04      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6B5G4_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6B5G4_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K5Z4C3_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6L933_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6L933_BMF-03      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A2K6RAW8_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
A0A0D9R4R5_BMF-01      IADQFHRLHV---QQHQQNRNRMWWQILLFL------HNLALNGEENRNG
F7HPK0_BMF-01          IADQFHRLHV---QQHQQNRNRMWWQVLLFL------HNLALNGEENRNG
A0A2K5E1W9_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQVLLFL------HNLALNGEENRNG
A0A2K6TW86_BMF-02      IADQFHRLHV---QQHQQNRNRVWWQVLLFL------HNLALNGEENRNG
A0A2K6TW86_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQVLLFL------HNLALNGEENRNG
G3QIN5_BMF-01          IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
Q96LC9_BMF-02          IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
Q96LC9_BMF-01          IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
Q96LC9_BMF-04          IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
Q96LC9_BMF-03          IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
A0A2R9BS98_BMF-01      IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
A0A2J8QDD5_BMF-02      IADQFHRLHV---QQHQQNQNRVWWQILLFL------HNLALNGEENRNG
A0A2J8T301_BMF-01      IADQFHRLHV---QQHQQNRNRVWWQILLFL------HNLALNGEENRNG
H9GL49_BMF-01          IADQFHRLHL---QRHQQNRNQVWWQIFFFL------HNVALNMEANRHR
K7FRX2_BMF-01          IADQFHRLHI---QRHQQNRNQVWWQILLFL------HNLALNVEANRNH
A9XRG9_BMF-02          IADQFHRLHI---QRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAA
A9XRG9_BMF-01          IADQFHRLHI---QRVGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAA
U3JS06_BMF-01          IADQFHRLHI---QRHQQNRNQVWWQLFLFL------HNLALNTEVNRNH
H0ZMX5_BMF-01          IADQFHRLHI---QRHQQNRNQVWWQLFLFL------HNLALNTEVNRNH
A9XRG9_BMF-03          IADQFHRLHI---QRHQQNRNQVWWQLFLFL------HNLALNVEANRNR
A9XRG9_BMF-04          IADQFHRLHI---QRHQQNRNQVWWQLFLFL------HNLALNVEANRNR
G1NHG8_BMF-01          IADQFHRLHI---QRHQQNRNQVWWQLFLFL------HNLALNVEANRNR
A0A3B4UNJ0_BMF-01      IGDKFQQDH---FMRHQRQNLPAWMRLTMAL------FGFLFPRQALVPR
Q0GKC7_BMF-01          IGDQFYQEHI---MHHQRPQDPLWRRVATAV------LTLLF-------G
W5N4P7_BMF-01          IGDQFHRDYLHMYRRNQRNHQPMWWRLALAL------FTFLFERQGNRNQ
A0A3B3RH63_BMF-01      IGDQFHQDQLQLYHRNQRNQQPVWWRLVMAL------CGLLFER-----R
W5UAU7_BMF-01          IGDQFYQEHM-LQHQNQRNQWPFWLRLASAL------YALLFDGEPAVHR
A0A3B1K1X5_BMF-01      IGDQFYQEHM-LQHRNQRNQQPLWLRLASAL------YTLLFEREPAAHG
A0A3B4CNJ8_BMF-01      IGDQFYQEHM-LQHRNQRNQQPFWLRLASAL------YTLLFEREPVANG
A0A2U9CJH3_BMF-01      IGDQFHREHLQLYHRNQRNQGPLWWRLAAAL------LSLLFDRGFLAGG
A0A3B5KWG6_BMF-01      IGDQFHRERVQLYQRNQRNQGPLWWRLGTAL------LSLLFDRGFVAGG
A0A3B3CGR9_BMF-01      IGDQFHRERLQLYHQNQRNQGPLWWRLTTAL------VSLLLDRGFIAGG
A0A3B3I0V9_BMF-04      IGDQFHRERLQLYHRNQRNQGPVWWRLATAL------VSLLFDRGFIAGA
A0A3B3I0V9_BMF-01      IGDQFHRERLQLYHRNQRNQGPVWWRLATAL------VSLLFDRGFIAGA
A0A3B3I0V9_BMF-02      IGDQFHRERLQLYHRNQRNQGPVWWRLATAL------VSLLFDRGFIAGA
A0A3B3I0V9_BMF-03      IGDQFHRERLQLYHRNQRNQGPVWWRLATAL------VSLLFDRGFIAGA
A0A3B4U5H8_BMF-01      IGDQFHREHLQLYHQNQRNQGPLWWRLAVAL------LSLLFDRGLIAGG
A0A3B4WM88_BMF-01      IGDQFHREHLQLYHQNQRNHGPLWWRLAAAL------LSLLFDRGLIAGG
I3K2D6_BMF-01          IGDQFHWERLQLYHRNQRNQGPMWWRLAAAL------LSLLFDRGFIAGG
A0A3B4ETH0_BMF-01      IGDQFHWERLQLYHRNQRNQGPMWWRLAAAI------LSLLFDRGFIAGG
A0A3B5B8F6_BMF-01      IGDQFHREHLQLYHRNQRNQGPLWWRLAAAL------LSLLFDRGFIAGG
A0A096LRV0_BMF-01      IGDQFHREHLQQYQQNQRNQGPLWWRMTAAL------LSLLFHRGFIAGG
A0A3B3WU80_BMF-01      IGDQFHREHLQQYQQNQRNQGPLWWRMTAAL------LSLLFHRGFIAGG
A0A3B5QK08_BMF-02      IGDQFHREHLQQYQQNQRNQGPLWWRMTAAL------LSLLFDRGFIAGG
A0A3B5QK08_BMF-01      IGDQFHREHLQQYQQNQRNQGPLWWRMTAAL------LSLLFDRGFIAGG
A9XRH0_BMF-01          -------------QRHQQNRNQVWWQLFLFL------HNLALNVEANRNR
A3KND0_BMF-01          -------------GKEALS------EIYRMF------NASIPHESHRFHR
                                                                         

A0A3B4B6Y3_BMF-01      --------------------------------------------------
F6TGJ4_BMF-01          LAQR----------------------------------------------
G1PAU1_BMF-01          AGPR----------------------------------------------
A2AV74_BMF-02          VGPW----------------------------------------------
A0A286XXB0_BMF-03      AGPR----------------------------------------------
I3MDS9_BMF-02          AGPR----------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-01      AGPR----------------------------------------------
A0A287AIU8_BMF-04      AGPR----------------------------------------------
A0A287AIU8_BMF-03      AGPR----------------------------------------------
A0A287AIU8_BMF-02      AGPR----------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          VGPW----------------------------------------------
Q8K589_BMF-01          VGPW----------------------------------------------
I3MDS9_BMF-01          AGPR----------------------------------------------
G3T7Z4_BMF-01          AGPR----------------------------------------------
F6X3N6_BMF-01          AGPR----------------------------------------------
G3WDQ2_BMF-01          AGPR----------------------------------------------
Q96LC9_BMF-06          AGPR----------------------------------------------
F6TJI0_BMF-02          AGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL---
F6TJI0_BMF-01          AGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLS--WS----
A0A286XXB0_BMF-02      AGPR----------------------------------------------
J9PB65_BMF-01          AGPSFQLVPGISCSGAQQDCSCL---------------------------
A0A286XXB0_BMF-01      AGPR----------------------------------------------
G1SR62_BMF-01          AGPR----------------------------------------------
Q05KI3_BMF-02          AGPR----------------------------------------------
Q05KI3_BMF-01          AGPR----------------------------------------------
W5QFV1_BMF-01          AGPR----------------------------------------------
M3WRS0_BMF-01          AGPR----------------------------------------------
M3YAD5_BMF-01          AGPR----------------------------------------------
A0A2U4BC98_BMF-01      AGPR----------------------------------------------
A0A2K6FFR1_BMF-01      AGPR----------------------------------------------
H0WYH6_BMF-01          AGPR----------------------------------------------
A0A096NTE9_BMF-01      VDPRYKNARRSVRKLKASSFLSCQPE------------------------
A0A2K6L933_BMF-02      AGPRPLTWNGGRCQTLLKGRLMCL--------------------------
A0A096NTE9_BMF-02      VDPRPLTWNGAVVKPC----------------------------------
A0A2K5MJY6_BMF-02      AGPR----------------------------------------------
A0A2K5KGR6_BMF-02      AGPR----------------------------------------------
G7PAW6_BMF-02          AGPR----------------------------------------------
F7CM09_BMF-02          AGPR----------------------------------------------
A0A2K6B5G4_BMF-04      AGPR----------------------------------------------
A0A2K6B5G4_BMF-02      AGPR----------------------------------------------
A0A2K6B5G4_BMF-01      AGPR----------------------------------------------
A0A2K5Z4C3_BMF-01      AGPR----------------------------------------------
A0A2K6L933_BMF-01      AGPR----------------------------------------------
A0A2K6L933_BMF-03      AGPR----------------------------------------------
A0A2K6RAW8_BMF-01      AGPR----------------------------------------------
A0A0D9R4R5_BMF-01      AGPR----------------------------------------------
F7HPK0_BMF-01          AGPR----------------------------------------------
A0A2K5E1W9_BMF-01      AGPR----------------------------------------------
A0A2K6TW86_BMF-02      AGPR----------------------------------------------
A0A2K6TW86_BMF-01      AGPR----------------------------------------------
G3QIN5_BMF-01          AGPR----------------------------------------------
Q96LC9_BMF-02          AGPR----------------------------------------------
Q96LC9_BMF-01          AGPR----------------------------------------------
Q96LC9_BMF-04          AGPR----------------------------------------------
Q96LC9_BMF-03          AGPR----------------------------------------------
A0A2R9BS98_BMF-01      AGPR----------------------------------------------
A0A2J8QDD5_BMF-02      AGPR----------------------------------------------
A0A2J8T301_BMF-01      AGPR----------------------------------------------
H9GL49_BMF-01          AGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI-----------------
K7FRX2_BMF-01          IGQR----------------------------------------------
A9XRG9_BMF-02          AGYRQ---------------------------------------------
A9XRG9_BMF-01          AGYRQ---------------------------------------------
U3JS06_BMF-01          TGQR----------------------------------------------
H0ZMX5_BMF-01          TGQR----------------------------------------------
A9XRG9_BMF-03          TGQR----------------------------------------------
A9XRG9_BMF-04          TGQR----------------------------------------------
G1NHG8_BMF-01          TGQR----------------------------------------------
A0A3B4UNJ0_BMF-01      LRGEQR--------------------------------------------
Q0GKC7_BMF-01          ARENRR--------------------------------------------
W5N4P7_BMF-01          LRGDQR--------------------------------------------
A0A3B3RH63_BMF-01      QRAEQR--------------------------------------------
W5UAU7_BMF-01          RRQEDRR-------------------------------------------
A0A3B1K1X5_BMF-01      RREDRR--------------------------------------------
A0A3B4CNJ8_BMF-01      RRVDQR--------------------------------------------
A0A2U9CJH3_BMF-01      GGAGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPAN
A0A3B5KWG6_BMF-01      GGAGRR--------------------------------------------
A0A3B3CGR9_BMF-01      GGAGQR--------------------------------------------
A0A3B3I0V9_BMF-04      GGAGQRQSVVSD--------------------------------------
A0A3B3I0V9_BMF-01      GGAGQR--------------------------------------------
A0A3B3I0V9_BMF-02      GGAGQR--------------------------------------------
A0A3B3I0V9_BMF-03      GGAGQR--------------------------------------------
A0A3B4U5H8_BMF-01      GGAGRR--------------------------------------------
A0A3B4WM88_BMF-01      GGAGRR--------------------------------------------
I3K2D6_BMF-01          GGGGRR--------------------------------------------
A0A3B4ETH0_BMF-01      GGGGRR--------------------------------------------
A0A3B5B8F6_BMF-01      GGAGRR--------------------------------------------
A0A096LRV0_BMF-01      GGAGRR--------------------------------------------
A0A3B3WU80_BMF-01      GGAGRR--------------------------------------------
A0A3B5QK08_BMF-02      GGAGRR--------------------------------------------
A0A3B5QK08_BMF-01      GGAGRR--------------------------------------------
A9XRH0_BMF-01          TGQR----------------------------------------------
A3KND0_BMF-01          LFQV----------------------------------------------
                                                                         

A0A3B4B6Y3_BMF-01      ---------
F6TGJ4_BMF-01          ---------
G1PAU1_BMF-01          ---------
A2AV74_BMF-02          ---------
A0A286XXB0_BMF-03      ---------
I3MDS9_BMF-02          ---------
A0A287AIU8_BMF-05      ---------
A0A287AIU8_BMF-01      ---------
A0A287AIU8_BMF-04      ---------
A0A287AIU8_BMF-03      ---------
A0A287AIU8_BMF-02      ---------
A0A2K5KGR6_BMF-01      ---------
A0A2K6FFR1_BMF-02      ---------
M3WRS0_BMF-02          ---------
A0A2K5E1W9_BMF-02      ---------
F7HPK0_BMF-02          ---------
A0A2K6TW86_BMF-03      ---------
A0A2K6RAW8_BMF-02      ---------
G3QIN5_BMF-02          ---------
Q96LC9_BMF-07          ---------
Q96LC9_BMF-05          ---------
A0A2R9BS98_BMF-02      ---------
A0A2J8QDD5_BMF-01      ---------
A0A2K5MJY6_BMF-01      ---------
G7PAW6_BMF-01          ---------
A0A2K6B5G4_BMF-03      ---------
A0A2K5Z4C3_BMF-02      ---------
A0A096NTE9_BMF-03      ---------
A0A2I3HD83_BMF-01      ---------
A2AV74_BMF-01          ---------
Q8K589_BMF-01          ---------
I3MDS9_BMF-01          ---------
G3T7Z4_BMF-01          ---------
F6X3N6_BMF-01          ---------
G3WDQ2_BMF-01          ---------
Q96LC9_BMF-06          ---------
F6TJI0_BMF-02          ---------
F6TJI0_BMF-01          ---------
A0A286XXB0_BMF-02      ---------
J9PB65_BMF-01          ---------
A0A286XXB0_BMF-01      ---------
G1SR62_BMF-01          ---------
Q05KI3_BMF-02          ---------
Q05KI3_BMF-01          ---------
W5QFV1_BMF-01          ---------
M3WRS0_BMF-01          ---------
M3YAD5_BMF-01          ---------
A0A2U4BC98_BMF-01      ---------
A0A2K6FFR1_BMF-01      ---------
H0WYH6_BMF-01          ---------
A0A096NTE9_BMF-01      ---------
A0A2K6L933_BMF-02      ---------
A0A096NTE9_BMF-02      ---------
A0A2K5MJY6_BMF-02      ---------
A0A2K5KGR6_BMF-02      ---------
G7PAW6_BMF-02          ---------
F7CM09_BMF-02          ---------
A0A2K6B5G4_BMF-04      ---------
A0A2K6B5G4_BMF-02      ---------
A0A2K6B5G4_BMF-01      ---------
A0A2K5Z4C3_BMF-01      ---------
A0A2K6L933_BMF-01      ---------
A0A2K6L933_BMF-03      ---------
A0A2K6RAW8_BMF-01      ---------
A0A0D9R4R5_BMF-01      ---------
F7HPK0_BMF-01          ---------
A0A2K5E1W9_BMF-01      ---------
A0A2K6TW86_BMF-02      ---------
A0A2K6TW86_BMF-01      ---------
G3QIN5_BMF-01          ---------
Q96LC9_BMF-02          ---------
Q96LC9_BMF-01          ---------
Q96LC9_BMF-04          ---------
Q96LC9_BMF-03          ---------
A0A2R9BS98_BMF-01      ---------
A0A2J8QDD5_BMF-02      ---------
A0A2J8T301_BMF-01      ---------
H9GL49_BMF-01          ---------
K7FRX2_BMF-01          ---------
A9XRG9_BMF-02          ---------
A9XRG9_BMF-01          ---------
U3JS06_BMF-01          ---------
H0ZMX5_BMF-01          ---------
A9XRG9_BMF-03          ---------
A9XRG9_BMF-04          ---------
G1NHG8_BMF-01          ---------
A0A3B4UNJ0_BMF-01      ---------
Q0GKC7_BMF-01          ---------
W5N4P7_BMF-01          ---------
A0A3B3RH63_BMF-01      ---------
W5UAU7_BMF-01          ---------
A0A3B1K1X5_BMF-01      ---------
A0A3B4CNJ8_BMF-01      ---------
A0A2U9CJH3_BMF-01      GRLPCALIG
A0A3B5KWG6_BMF-01      ---------
A0A3B3CGR9_BMF-01      ---------
A0A3B3I0V9_BMF-04      ---------
A0A3B3I0V9_BMF-01      ---------
A0A3B3I0V9_BMF-02      ---------
A0A3B3I0V9_BMF-03      ---------
A0A3B4U5H8_BMF-01      ---------
A0A3B4WM88_BMF-01      ---------
I3K2D6_BMF-01          ---------
A0A3B4ETH0_BMF-01      ---------
A0A3B5B8F6_BMF-01      ---------
A0A096LRV0_BMF-01      ---------
A0A3B3WU80_BMF-01      ---------
A0A3B5QK08_BMF-02      ---------
A0A3B5QK08_BMF-01      ---------
A9XRH0_BMF-01          ---------
A3KND0_BMF-01          ---------
                                

© 1998-2019