Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

149 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6TGJ4_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
I3MDS9_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-04      --------------------------------------------------
A0A287AIU8_BMF-03      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q8K589_BMF-01          --------------------------------------------------
I3MDS9_BMF-01          MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP------------
G3T7Z4_BMF-01          MPRAGVFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPPLPAELFPSFPI
F6X3N6_BMF-01          --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
F6TJI0_BMF-02          --------------------------------------------------
F6TJI0_BMF-01          --------------------------------------------------
A0A286XXB0_BMF-02      ----------------------------------MPGAGVFWKQYRARRR
J9PB65_BMF-01          --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
M3WRS0_BMF-01          --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A2K5MJY6_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-02      --------------------------------------------------
G7PAW6_BMF-02          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5G4_BMF-01      --------------------------------------------------
A0A2K6B5G4_BMF-02      --------------------------------------------------
A0A2K6B5G4_BMF-04      --------------------------------------------------
A0A2K5Z4C3_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-03      --------------------------------------------------
A0A2K6L933_BMF-01      --------------------------------------------------
A0A2K6RAW8_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
F7HPK0_BMF-01          --------------------------------------------------
A0A2K5E1W9_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-02      --------------------------------------------------
A0A2K6TW86_BMF-01      --------------------------------------------------
G3QIN5_BMF-01          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRG9_BMF-02          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A9XRG9_BMF-03          --------------------------------------------------
A9XRG9_BMF-04          --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2E3E8_BMF-02      --------------------------------------------------
A0A3Q2E3E8_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-04      --------------------------------------------------
A0A3B3I0V9_BMF-02      --------------------------------------------------
A0A3B3I0V9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-03      --------------------------------------------------
A0A3P9JM16_BMF-03      --------------------------------------------------
A0A3P9JM16_BMF-02      --------------------------------------------------
A0A3P9JM16_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3LME3_BMF-01      --------------------------------------------------
A0A3Q3LME3_BMF-02      --------------------------------------------------
A0A3Q3LME3_BMF-03      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

F6TGJ4_BMF-01          ------------------------------------QESYLNMDE-----
A0A452H3N6_BMF-01      ------------------------------------MDPPNYLEDDYSSL
G1PAU1_BMF-01          ------------------------------------MEPPQCVEE-----
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEE-----
A0A286XXB0_BMF-03      -------------------------------VFPREMEPPQCVEE-----
I3MDS9_BMF-02          -------------------------------VFPEEMEPPQCVEE-----
A0A287AIU8_BMF-05      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-04      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-03      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-01      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-02      ------------------------------------MEPPQCVEE-----
A0A2K5KGR6_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6FFR1_BMF-02      ------------------------------------MEPSHCVEE-----
M3WRS0_BMF-02          ------------------------------------MEPPQCVEE-----
A0A2K5E1W9_BMF-02      ------------------------------------MEPSQCVEE-----
F7HPK0_BMF-02          ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-03      ------------------------------------MEPSQCVEE-----
A0A2K6RAW8_BMF-02      ------------------------------------MEPSRCVEE-----
G3QIN5_BMF-02          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-07          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-05          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K5MJY6_BMF-01      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-01          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2I3HD83_BMF-01      ------------------------------------MEPSQCVEE-----
A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEE-----
Q8K589_BMF-01          ------------------------------------MEPPQCVEE-----
I3MDS9_BMF-01          GSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEE-----
G3T7Z4_BMF-01          ESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEE-----
F6X3N6_BMF-01          ------------------------------------MEPPHYVEE-----
G3WDQ2_BMF-01          ------------------------------------MESPHYVEE-----
Q96LC9_BMF-06          ------------------------------------MEPSQCVEE-----
F6TJI0_BMF-02          ------------------------------------MEPPQCVEE-----
F6TJI0_BMF-01          ------------------------------------MEPPQCVEE-----
A0A286XXB0_BMF-02      RRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEE-----
J9PB65_BMF-01          ------------------------------------MEPPQCVEE-----
A0A286XXB0_BMF-01      ------------------------------------MEPPQCVEE-----
G1SR62_BMF-01          ------------------------------------MEPPQCVEE-----
W5QFV1_BMF-01          --------------------------------LTGEMEPPQCVEE-----
Q05KI3_BMF-01          ------------------------------------MEPPQCVEE-----
Q05KI3_BMF-02          ------------------------------------MEPPQCVEE-----
A0A452F2E0_BMF-02      ------------------------------------MEPPQCVEE-----
A0A452F2E0_BMF-01      ------------------------------------MEPPQCVEE-----
M3WRS0_BMF-01          ------------------------------------MEPPQCVEE-----
A0A2U4BC98_BMF-01      ------------------------------------MEPPQCVEE-----
M3YAD5_BMF-01          ------------------------------------MEPPQCVEE-----
A0A452SED0_BMF-01      ------------------------------------MEPPQCVEE-----
A0A384D070_BMF-01      ------------------------------------MEPPQCVEE-----
A0A2K6FFR1_BMF-01      ------------------------------------MEPSHCVEE-----
H0WYH6_BMF-01          ------------------------------------MEPSQCVEE-----
A0A096NTE9_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5MJY6_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5KGR6_BMF-02      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-02          ------------------------------------MEPSRCVEE-----
F7CM09_BMF-02          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-04      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6RAW8_BMF-01      ------------------------------------MEPSRCVEE-----
A0A0D9R4R5_BMF-01      ------------------------------------MEPSRCVEE-----
F7HPK0_BMF-01          ------------------------------------MEPSQCVEE-----
A0A2K5E1W9_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-01      ------------------------------------MEPSQCVEE-----
G3QIN5_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-04          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-03          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-02          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8T301_BMF-01      ------------------------------------MEPSQCVEE-----
H9GL49_BMF-01          ------------------------------------MDPPGYLDDDFSTL
K7FRX2_BMF-01          ------------------------------------MDPPSYLEEDYSSL
A9XRG9_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-02          ------------------------------------MDRPSYLEEDYSSL
U3JS06_BMF-01          ------------------------------------MDRPSYLEEDYSSL
H0ZMX5_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-03          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-04          ------------------------------------MDRPSYLEEDYSSL
G1NHG8_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A0A3B4UNJ0_BMF-01      ------------------------------------------MDD-----
A0A3B4B6Y3_BMF-01      ------------------------------------------MED-----
Q0GKC7_BMF-01          ------------------------------------------MDE-----
A0A3B3RH63_BMF-01      ------------------------------------------MDD-----
W5N4P7_BMF-01          ------------------------------------------MEE-----
A0A3B1K1X5_BMF-01      ------------------------------------------MDD-----
A0A3B4CNJ8_BMF-01      ------------------------------------------MDE-----
A0A2U9CJH3_BMF-01      ------------------------------------------MDD-----
A0A3Q2YCX7_BMF-01      ------------------------------------------MED-----
A0A3Q2YCX7_BMF-02      ------------------------------------------MED-----
A0A3P8ZIE7_BMF-01      ------------------------------------------MED-----
A0A3Q3QZ16_BMF-01      ------------------------------------------MDD-----
A0A3Q3QZ16_BMF-02      ------------------------------------------MDD-----
A0A3Q2PJX9_BMF-02      ------------------------------------------MED-----
A0A3Q2PJX9_BMF-03      ------------------------------------------MED-----
A0A3Q2PJX9_BMF-01      ------------------------------------------MED-----
A0A3B5QK08_BMF-01      ------------------------------------------MED-----
A0A3B5QK08_BMF-02      ------------------------------------------MED-----
A0A096LRV0_BMF-01      ------------------------------------------MED-----
A0A3B3WU80_BMF-01      ------------------------------------------MED-----
A0A3P9Q8E2_BMF-01      ------------------------------------------MED-----
A0A3Q2E3E8_BMF-02      ------------------------------------------MEE-----
A0A3Q2E3E8_BMF-01      ------------------------------------------MEE-----
A0A3Q3GUU5_BMF-01      ------------------------------------------MDD-----
A0A3B5B8F6_BMF-01      ------------------------------------------MDD-----
A0A3P8UA78_BMF-01      ------------------------------------------MDD-----
A0A3P8UA78_BMF-03      ------------------------------------------MDD-----
A0A3P8UA78_BMF-02      ------------------------------------------MDD-----
A0A3B3CGR9_BMF-01      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-04      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-02      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-01      ------------------------------------------MDD-----
A0A3B3I0V9_BMF-03      ------------------------------------------MDD-----
A0A3P9JM16_BMF-03      ------------------------------------------MDD-----
A0A3P9JM16_BMF-02      ------------------------------------------MDD-----
A0A3P9JM16_BMF-01      ------------------------------------------MDD-----
A0A3Q2ZA20_BMF-01      ------------------------------------------MDD-----
A0A3P8NFE2_BMF-02      ------------------------------------------MDD-----
I3K2D6_BMF-01          ------------------------------------------MDD-----
A0A3P8NFE2_BMF-01      ------------------------------------------MDD-----
A0A3Q3C5V2_BMF-01      ------------------------------------------MDD-----
A0A3P9DPJ5_BMF-02      ------------------------------------------MDD-----
A0A3P9DPJ5_BMF-01      ------------------------------------------MDD-----
A0A3B4ETH0_BMF-01      ------------------------------------------MDD-----
A0A3Q4G1I4_BMF-01      ------------------------------------------MDD-----
A0A3Q1FVH7_BMF-01      ------------------------------------------MDD-----
A0A3Q1FVH7_BMF-02      ------------------------------------------MDD-----
A0A3Q1D1K3_BMF-01      ------------------------------------------MDD-----
A0A3P8RKY9_BMF-01      ------------------------------------------MDD-----
A0A3Q1IPR4_BMF-01      ------------------------------------------MDD-----
A0A3B4U5H8_BMF-01      ------------------------------------------MDD-----
A0A3B4WM88_BMF-01      ------------------------------------------MDD-----
A0A3Q3LME3_BMF-01      ------------------------------------------MDD-----
A0A3Q3LME3_BMF-02      ------------------------------------------MDD-----
A0A3Q3LME3_BMF-03      ------------------------------------------MDD-----
A0A3Q3VLX6_BMF-01      ------------------------------------------MDD-----
A0A3B5KWG6_BMF-01      ------------------------------------------MDD-----
A9XRH0_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A3KND0_BMF-01          -------------------------------------------------M
                                                                         

F6TGJ4_BMF-01          --LDDDVFYPD--EFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCC
A0A452H3N6_BMF-01      DGLDDDVFHSDFGLTG-QPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCC
G1PAU1_BMF-01          --LEDDVFQPED-ELGTQPGSLPSADLFAQSQ-LDCPLSRLQLFPLTHCC
A2AV74_BMF-02          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A286XXB0_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
I3MDS9_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-05      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-04      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-03      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-01      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-02      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A2K5KGR6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6FFR1_BMF-02      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-02          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
A0A2K5E1W9_BMF-02      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-07          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-05          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-01          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2I3HD83_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A2AV74_BMF-01          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
Q8K589_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
I3MDS9_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
G3T7Z4_BMF-01          --LEDDVFQPEEGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
F6X3N6_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSAALFAQSQ-PDYMLDGLQLFPLTHCC
G3WDQ2_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSPALFAQSQ-PDYMLDGLQLFPLTHCC
Q96LC9_BMF-06          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
F6TJI0_BMF-02          --LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLRLFPLTHCC
F6TJI0_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLRLFPLTHCC
A0A286XXB0_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
J9PB65_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A286XXB0_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
G1SR62_BMF-01          --LEDDVFQPEDGEPGTQPQSLLSADPFAQSQ-LDCPLGRLHLFPLTHCC
W5QFV1_BMF-01          --LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
Q05KI3_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
Q05KI3_BMF-02          --LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A452F2E0_BMF-02      --LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A452F2E0_BMF-01      --LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-01          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
A0A2U4BC98_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3YAD5_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A452SED0_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A384D070_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A2K6FFR1_BMF-01      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
H0WYH6_BMF-01          --LEDDVFQPEDGELGT--GNVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5KGR6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-02          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7CM09_BMF-02          --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-04      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A0D9R4R5_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5E1W9_BMF-01      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-04          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-03          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8T301_BMF-01      --LEDDVFQPEDGEPGTQSGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
H9GL49_BMF-01          DGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCC
K7FRX2_BMF-01          DGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-02          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
U3JS06_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
H0ZMX5_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-03          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-04          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
G1NHG8_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A0A3B4UNJ0_BMF-01      --EEEDMSQPI-----------------------------------SHLW
A0A3B4B6Y3_BMF-01      --EEDDVFEPD-----------------------------------LHCW
Q0GKC7_BMF-01          --DEDDVFRKG-----------------------------------LQHW
A0A3B3RH63_BMF-01      --DDDDVFHTD-----------------------------------PLTY
W5N4P7_BMF-01          --DEDDVFHPSH---------------------------------FSHCW
A0A3B1K1X5_BMF-01      --EEDDVFVTD-----------------------------------PEPW
A0A3B4CNJ8_BMF-01      --DEDDVFVMD-----------------------------------TQYW
A0A2U9CJH3_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3Q2YCX7_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3Q2YCX7_BMF-02      --EEDDVFEPD-----------------------------------PHCW
A0A3P8ZIE7_BMF-01      --EEDDVFEPD-----------------------------------SYCW
A0A3Q3QZ16_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3Q3QZ16_BMF-02      --EEDDVFEPD-----------------------------------PHCW
A0A3Q2PJX9_BMF-02      --EEDDVFEPD-----------------------------------PNCW
A0A3Q2PJX9_BMF-03      --EEDDVFEPD-----------------------------------PNCW
A0A3Q2PJX9_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3B5QK08_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3B5QK08_BMF-02      --EEDDVFEPD-----------------------------------PNCW
A0A096LRV0_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3B3WU80_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3P9Q8E2_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A3Q2E3E8_BMF-02      --EEDDVFEPD-----------------------------------PNSW
A0A3Q2E3E8_BMF-01      --EEDDVFEPD-----------------------------------PNSW
A0A3Q3GUU5_BMF-01      --EEDDVFEPD-----------------------------------PHSW
A0A3B5B8F6_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3P8UA78_BMF-01      --EEDDVFEPD-----------------------------------PHSW
A0A3P8UA78_BMF-03      --EEDDVFEPD-----------------------------------PHSW
A0A3P8UA78_BMF-02      --EEDDVFEPD-----------------------------------PHSW
A0A3B3CGR9_BMF-01      --EEDDVFEPD-----------------------------------PNNW
A0A3B3I0V9_BMF-04      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-02      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-01      --EEDDVFEPD-----------------------------------PNKW
A0A3B3I0V9_BMF-03      --EEDDVFEPD-----------------------------------PNKW
A0A3P9JM16_BMF-03      --EEDDVFEPD-----------------------------------PNKW
A0A3P9JM16_BMF-02      --EEDDVFEPD-----------------------------------PNKW
A0A3P9JM16_BMF-01      --EEDDVFEPD-----------------------------------PNKW
A0A3Q2ZA20_BMF-01      --EEDDVFEPD-----------------------------------PSCW
A0A3P8NFE2_BMF-02      --EEDDVFEPK-----------------------------------ANCW
I3K2D6_BMF-01          --EEDDVFEPK-----------------------------------ANCW
A0A3P8NFE2_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3Q3C5V2_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3P9DPJ5_BMF-02      --EEDDVFEPK-----------------------------------ANCW
A0A3P9DPJ5_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3B4ETH0_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3Q4G1I4_BMF-01      --EEDDVFEPK-----------------------------------ANCW
A0A3Q1FVH7_BMF-01      --EEDDVFEPD-----------------------------------THCW
A0A3Q1FVH7_BMF-02      --EEDDVFEPD-----------------------------------THCW
A0A3Q1D1K3_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3P8RKY9_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3Q1IPR4_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3B4U5H8_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3B4WM88_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A0A3Q3LME3_BMF-01      --EEDDVFEPD-----------------------------------PHFW
A0A3Q3LME3_BMF-02      --EEDDVFEPD-----------------------------------PHFW
A0A3Q3LME3_BMF-03      --EEDDVFEPD-----------------------------------PHFW
A0A3Q3VLX6_BMF-01      --DEDDVFEPE-----------------------------------AHCW
A0A3B5KWG6_BMF-01      --EEDDVFQPD-----------------------------------PYSW
A9XRH0_BMF-01          DGLDDDVFHSD--DFGLAGNA-----------GY-----RLHVPPVGFAL
A3KND0_BMF-01          DELDDDVFYPD--AFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCC
                          ::*:                                           

F6TGJ4_BMF-01          GPGCRGADYEDKATQTLGSPSISQDIMLPCGVSETPQRLFYGHAGYLLYL
A0A452H3N6_BMF-01      GPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHV
G1PAU1_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A2AV74_BMF-02          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-03      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
I3MDS9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-05      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-04      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A287AIU8_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5KGR6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K6FFR1_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSHV
M3WRS0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAKPPSSV
A0A2K5E1W9_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYASAEPKSRV
F7HPK0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSHV
A0A2K6TW86_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2K6RAW8_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
G3QIN5_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
Q96LC9_BMF-07          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
Q96LC9_BMF-05          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2R9BS98_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2J8QDD5_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCV
A0A2K5MJY6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
G7PAW6_BMF-01          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K6B5G4_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2K5Z4C3_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A096NTE9_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A0A2I3HD83_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRV
A2AV74_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q8K589_BMF-01          GPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
I3MDS9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G3T7Z4_BMF-01          GPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6X3N6_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPL
G3WDQ2_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPL
Q96LC9_BMF-06          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6TJI0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F6TJI0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-02      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
J9PB65_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A286XXB0_BMF-01      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G1SR62_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
W5QFV1_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q05KI3_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPL
Q05KI3_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHAGYRLPL
A0A452F2E0_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A452F2E0_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
M3WRS0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2U4BC98_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
M3YAD5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A452SED0_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A384D070_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6FFR1_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
H0WYH6_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNVGYRLPL
A0A096NTE9_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A096NTE9_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5MJY6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5KGR6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G7PAW6_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F7CM09_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6B5G4_BMF-04      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5Z4C3_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6L933_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6RAW8_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A0D9R4R5_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
F7HPK0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K5E1W9_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6TW86_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2K6TW86_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
G3QIN5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-04          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-03          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
Q96LC9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2R9BS98_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2J8QDD5_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
A0A2J8T301_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL
H9GL49_BMF-01          GPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHV
K7FRX2_BMF-01          GPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHE
A9XRG9_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A9XRG9_BMF-02          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
U3JS06_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHV
H0ZMX5_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHV
A9XRG9_BMF-03          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A9XRG9_BMF-04          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
G1NHG8_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHV
A0A3B4UNJ0_BMF-01      GTSFRDVKYEDRATPIAA-------GQALTAVTAAPLILFVWWVPHWELS
A0A3B4B6Y3_BMF-01      HTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFY---------
Q0GKC7_BMF-01          PPPHLQIK----QTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLA
A0A3B3RH63_BMF-01      QPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYGSAGLRLHF
W5N4P7_BMF-01          GTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNAAFRLHF
A0A3B1K1X5_BMF-01      RSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLA
A0A3B4CNJ8_BMF-01      RSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLA
A0A2U9CJH3_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q2YCX7_BMF-01      RTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q2YCX7_BMF-02      RTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P8ZIE7_BMF-01      HTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYGNAGFRLHF
A0A3Q3QZ16_BMF-01      RTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHF
A0A3Q3QZ16_BMF-02      RTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHF
A0A3Q2PJX9_BMF-02      RTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHF
A0A3Q2PJX9_BMF-03      RTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHF
A0A3Q2PJX9_BMF-01      RTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHF
A0A3B5QK08_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHF
A0A3B5QK08_BMF-02      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHF
A0A096LRV0_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHF
A0A3B3WU80_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHF
A0A3P9Q8E2_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHF
A0A3Q2E3E8_BMF-02      HTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHF
A0A3Q2E3E8_BMF-01      HTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHF
A0A3Q3GUU5_BMF-01      RTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B5B8F6_BMF-01      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P8UA78_BMF-01      HTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHF
A0A3P8UA78_BMF-03      HTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHF
A0A3P8UA78_BMF-02      HTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHF
A0A3B3CGR9_BMF-01      RTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-04      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-02      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-01      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3B3I0V9_BMF-03      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3P9JM16_BMF-03      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3P9JM16_BMF-02      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3P9JM16_BMF-01      RTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHF
A0A3Q2ZA20_BMF-01      RTTFREIKCEDRGTQTPGPALVPHSGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P8NFE2_BMF-02      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
I3K2D6_BMF-01          RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P8NFE2_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q3C5V2_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P9DPJ5_BMF-02      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P9DPJ5_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B4ETH0_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q4G1I4_BMF-01      RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q1FVH7_BMF-01      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q1FVH7_BMF-02      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q1D1K3_BMF-01      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3P8RKY9_BMF-01      RTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q1IPR4_BMF-01      RTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3B4U5H8_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHF
A0A3B4WM88_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHF
A0A3Q3LME3_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q3LME3_BMF-02      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q3LME3_BMF-03      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHF
A0A3Q3VLX6_BMF-01      RTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYVTSSLAPDS
A0A3B5KWG6_BMF-01      RTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGEAGDTLHY
A9XRH0_BMF-01          DPNLQ-EEPQEGQREART--EVQIARKLQC-IADQFHRLHI---------
A3KND0_BMF-01          GPGCRGTDNEDKATQTLG--SPSQDIMLPCGVSETPQRLFY---------
                        .                                    :           

F6TGJ4_BMF-01          -P-QNSPA--RFGEEVDN-------------------------RRQ-EQS
A0A452H3N6_BMF-01      PP-VGFALNPHLQEEPRE-------------------------GQR-EAL
G1PAU1_BMF-01          -P-ASFPAGSPLGEQPPE-------------------------GQWQHHR
A2AV74_BMF-02          -P-ASFPAGSPLGEQPPE-------------------------GQFLQHR
A0A286XXB0_BMF-03      -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
I3MDS9_BMF-02          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
A0A287AIU8_BMF-05      -P-AGFPAGLPLGEQPPE-------------------------GQW-QHR
A0A287AIU8_BMF-04      -P-AGFPAGLPLGEQPPE-------------------------GQW-QHR
A0A287AIU8_BMF-03      -P-AGFPAGLPLGEQPPE-------------------------GQW-QHR
A0A287AIU8_BMF-01      -P-AGFPAGLPLGEQPPE-------------------------GQW-QHR
A0A287AIU8_BMF-02      -P-AGFPAGLPLGEQPPE-------------------------GQW-QHR
A0A2K5KGR6_BMF-01      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2K6FFR1_BMF-02      -V-ADPPL-------PTQ-------------------------PCF-ERR
M3WRS0_BMF-02          -V-ADSPL-------PTQ-------------------------PGF-ECR
A0A2K5E1W9_BMF-02      -V-AGPPL-------SAQ-------------------------PGF-EWR
F7HPK0_BMF-02          -V-AGPPL-------PAQ-------------------------PGF-EWR
A0A2K6TW86_BMF-03      -V-AGPPL-------PAQ-------------------------PGF-EWR
A0A2K6RAW8_BMF-02      -V-ADPPL-------PAQ-------------------------PCF-EWR
G3QIN5_BMF-02          -V-ADPPL-------PAQ-------------------------PCF-EWR
Q96LC9_BMF-07          -V-ADPPL-------PAQ-------------------------PCF-EWR
Q96LC9_BMF-05          -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2R9BS98_BMF-02      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2J8QDD5_BMF-01      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2K5MJY6_BMF-01      -V-ADPPL-------PAQ-------------------------PCF-EWR
G7PAW6_BMF-01          -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2K6B5G4_BMF-03      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2K5Z4C3_BMF-02      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A096NTE9_BMF-03      -V-ADPPL-------PAQ-------------------------PCF-EWR
A0A2I3HD83_BMF-01      -V-ADPPL-------PAQ-------------------------PCF-EWR
A2AV74_BMF-01          -P-ASFPAGSPLGEQPPE-------------------------GQFLQHR
Q8K589_BMF-01          -P-ASFPAGSALGEQPPE-------------------------GQFLQHR
I3MDS9_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
G3T7Z4_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
F6X3N6_BMF-01          -P-ASFPASLRLGEEPPE-------------------------EQW-EHR
G3WDQ2_BMF-01          -P-ANFPSSLRLGAEPPE-------------------------EQW-EHR
Q96LC9_BMF-06          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHQ
F6TJI0_BMF-02          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
F6TJI0_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
A0A286XXB0_BMF-02      -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
J9PB65_BMF-01          -P-ASFPAGLPLLEQPPE-------------------------GQW-QHR
A0A286XXB0_BMF-01      -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
G1SR62_BMF-01          -P-ASFPANFALGEQPPE-------------------------GQW-QHR
W5QFV1_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
Q05KI3_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
Q05KI3_BMF-02          -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
A0A452F2E0_BMF-02      -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
A0A452F2E0_BMF-01      -P-ASFPAGLPLGEQPPE-------------------------GQW-QHR
M3WRS0_BMF-01          -P-ASFPAGLPLGEQPPE-------------------------GHW-QHR
A0A2U4BC98_BMF-01      -P-AGFPAGLPLGEQPAE-------------------------GQW-QHR
M3YAD5_BMF-01          -P-ASFPAGLPLGDQPPE-------------------------GQW-QHR
A0A452SED0_BMF-01      -P-ASFPAGLPLGEQPPE-------------------------GPW-QHR
A0A384D070_BMF-01      -P-ASFPAGLPLGEQPPE-------------------------GPW-QHR
A0A2K6FFR1_BMF-01      -P-ASFPAGLPLGEQPAE-------------------------GQW-QHR
H0WYH6_BMF-01          -P-ASFPAGLPIGEQPPE-------------------------GQW-QHR
A0A096NTE9_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6L933_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A096NTE9_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K5MJY6_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K5KGR6_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
G7PAW6_BMF-02          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
F7CM09_BMF-02          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6B5G4_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6B5G4_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6B5G4_BMF-04      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K5Z4C3_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6L933_BMF-03      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6L933_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2K6RAW8_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A0D9R4R5_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
F7HPK0_BMF-01          -P-ASFPAVLPLGEQPPE-------------------------GQW-QHR
A0A2K5E1W9_BMF-01      -P-ASFPAVLPLGEQPPE-------------------------GQW-QHR
A0A2K6TW86_BMF-02      -P-ASFPAVLPLGEQPPE-------------------------GQW-QHR
A0A2K6TW86_BMF-01      -P-ASFPAVLPLGEQPPE-------------------------GQW-QHR
G3QIN5_BMF-01          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
Q96LC9_BMF-01          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHQ
Q96LC9_BMF-04          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHQ
Q96LC9_BMF-03          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHQ
Q96LC9_BMF-02          -P-ASFPAVLPIGEQPPE-------------------------GQW-QHQ
A0A2R9BS98_BMF-01      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2J8QDD5_BMF-02      -P-ASFPAVLPIGEQPPE-------------------------GQW-QHR
A0A2J8T301_BMF-01      -P-ASFPAVLPTGEQPPE-------------------------GQW-QHR
H9GL49_BMF-01          SP-IGFSLNPHFQEEPQE-------------------------SPQ-ELR
K7FRX2_BMF-01          PP-VGFALNPHLQEEPRE-------------------------GHQ-EAR
A9XRG9_BMF-01          PP-VGFALDPNLQEEPQE-------------------------GQR-EAR
A9XRG9_BMF-02          PP-VGFALDPNLQEEPQE-------------------------GQR-EAR
U3JS06_BMF-01          PP-AGFVLDPHLQEEPQE-------------------------GQR-EAR
H0ZMX5_BMF-01          PP-AGFVLDPHLQEEPQE-------------------------GQR-EAR
A9XRG9_BMF-03          PP-VGFALDPNLQEEPQE-------------------------GQR-EAR
A9XRG9_BMF-04          PP-VGFALDPNLQEEPQE-------------------------GQR-EAR
G1NHG8_BMF-01          PP-VGFALDPNLQEEPQE-------------------------GQR-EAR
A0A3B4UNJ0_BMF-01      -PSTKMNMLRFSENRPEE-----------------------Q----AGVS
A0A3B4B6Y3_BMF-01      ---AHFELGEDQEASESLQEGEMQNGREPLP----------RHPV-AVRS
Q0GKC7_BMF-01          -A----------SSRAQPPDVVLRQNVSPME----------RPEPRPAQS
A0A3B3RH63_BMF-01      -P-ALSVPGGHPPQEERQ-----------------------PDDR-PQPS
W5N4P7_BMF-01          -P-AHFEQGGDEEEETGE-----------------------AEEQ-PVRS
A0A3B1K1X5_BMF-01      -PSARSERVGDAMFREEH--------RAVEP----------RRRP--AHS
A0A3B4CNJ8_BMF-01      -PSVRPEHVEGAMLQEDQ--------LAMEP----------RRRP--PHS
A0A2U9CJH3_BMF-01      -P-AHFELFGDQEVRGHE-SEEERSGMEQLPR---------QQQP-VAHS
A0A3Q2YCX7_BMF-01      -P-AHFELVGEQEERLQESDDGMEQQLQQQQ----------QQQP-VARS
A0A3Q2YCX7_BMF-02      -P-AHFELVGEQEERLQESDDGMEQQLQQQQ----------QQQP-VARS
A0A3P8ZIE7_BMF-01      -P-AQFECVGDPGPQQRP--QAVRGGMEH------------PQQL-PQQP
A0A3Q3QZ16_BMF-01      -P-AHFELVGDQEARRQE----DQNGMEHLP----------RQQR-VARS
A0A3Q3QZ16_BMF-02      -P-AHFELVGDQEARRQE----DQNGMEHLP----------RQQR-VARS
A0A3Q2PJX9_BMF-02      -P-AHFELVGDFDARRQE----EQNRMEPLP----------LHQP-AALS
A0A3Q2PJX9_BMF-03      -P-AHFELVGDFDARRQE----EQNRMEPLP----------LHQP-AALS
A0A3Q2PJX9_BMF-01      -P-AHFELVGDFDARRQE----EQNRMEPLP----------LHQP-AALS
A0A3B5QK08_BMF-01      -P-AHFELVGDFDARQQE----EQNRMEQLP----------LHQP-AALS
A0A3B5QK08_BMF-02      -P-AHFELVGDFDARQQE----EQNRMEQLP----------LHQP-AALS
A0A096LRV0_BMF-01      -P-AHFELVGDFDARQQE----EQNRMEQLP----------LHQP-AALS
A0A3B3WU80_BMF-01      -P-AHFELVGDFDARQQE----EQNRMEQLP----------LHQP-AALS
A0A3P9Q8E2_BMF-01      -P-AHFELVRDFDARQQE----EQNRMEQLP----------LHQP-AALS
A0A3Q2E3E8_BMF-02      -P-AHFELVGDFDVRRQA----EHNRMEQLP----------LQQP-AALS
A0A3Q2E3E8_BMF-01      -P-AHFELVGDFDVRRQA----EHNRMEQLP----------LQQP-AALS
A0A3Q3GUU5_BMF-01      -P-ANFELVGDQEESGQE-SELQQIGMEQ-------------QQP-VAHS
A0A3B5B8F6_BMF-01      -P-ARFELIGDHQARQQQGSEMEQNGMEQLP----------RQQP-VARS
A0A3P8UA78_BMF-01      -P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQQP-VQRS
A0A3P8UA78_BMF-03      -P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQQP-VQRS
A0A3P8UA78_BMF-02      -P-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQQP-VQRS
A0A3B3CGR9_BMF-01      -P-ARFELAGDLEARRHD-REAERGGMERLP----------RQQP-AARS
A0A3B3I0V9_BMF-04      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3B3I0V9_BMF-02      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3B3I0V9_BMF-01      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3B3I0V9_BMF-03      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3P9JM16_BMF-03      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3P9JM16_BMF-02      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3P9JM16_BMF-01      -P-ARFELAGDLEVRRHD-REAERRGMERLP----------RQQP-VARS
A0A3Q2ZA20_BMF-01      -P-ARFELIRDLEARQQD-REEEPNRMERLP----------RQLP-VARS
A0A3P8NFE2_BMF-02      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
I3K2D6_BMF-01          -P-ARFELVGDHRARRQE-IAEQQNSMERLP----------RQRP-AARS
A0A3P8NFE2_BMF-01      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3Q3C5V2_BMF-01      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3P9DPJ5_BMF-02      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3P9DPJ5_BMF-01      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3B4ETH0_BMF-01      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3Q4G1I4_BMF-01      -P-ARFELVGDHRASRQG-STEQQNSMERLP----------RQRP-AARS
A0A3Q1FVH7_BMF-01      -P-AHFELI----ARQQG-SEMEQNGMEQLP----------RQQP-MAHS
A0A3Q1FVH7_BMF-02      -P-AHFELI----ARQQG-SEMEQNGMEQLP----------RQQP-MAHS
A0A3Q1D1K3_BMF-01      -P-ARFELIGNHQARQQG-SEMEQNGMEQLP----------RQQP-VARS
A0A3P8RKY9_BMF-01      -P-ARFELIGNHQARQQG-SEMEQNGMEQLP----------RQQP-VARS
A0A3Q1IPR4_BMF-01      -P-AHFELVGDLEVRQQD-SEEEQNGMEIPP----------RQQP-LMQS
A0A3B4U5H8_BMF-01      -P-AHFELVGDQEARRQG-SGEERNGMEQLP----------RQQP-VARS
A0A3B4WM88_BMF-01      -P-AHFELVGDQEARRQG-SGEERNGMEQLP----------RQQP-VARS
A0A3Q3LME3_BMF-01      -P-AHFELVGDQEVRQQE-REEEQNRMEQLP----------RQQP-LVHS
A0A3Q3LME3_BMF-02      -P-AHFELVGDQEVRQQE-REEEQNRMEQLP----------RQQP-LVHS
A0A3Q3LME3_BMF-03      -P-AHFELVGDQEVRQQE-REEEQNRMEQLP----------RQQP-LVHS
A0A3Q3VLX6_BMF-01      ----------------RD-NCRERNGMERLP----------RQQP-VAHS
A0A3B5KWG6_BMF-01      ----------------TG-GA--PNGMEPLP----------QQGP-VVRS
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

F6TGJ4_BMF-01          AEHRIARKLQCIGDQFHRFHL---------QRLQQNRN------QFWS--
A0A452H3N6_BMF-01      AEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
G1PAU1_BMF-01          AEIQIARKLQSIADQFHRLQM---------QQHQQNRN------RMWW--
A2AV74_BMF-02          AEVQIARKLQCIADQFHRLHT---------QQHQQNRD------RAWW--
A0A286XXB0_BMF-03      AEVQIARKLQCIADQFHRLHI---------QQHQQNRN------RAWW--
I3MDS9_BMF-02          AEVQIARKLQCIADQFHRLHM---------QQHQQNRN------RVWW--
A0A287AIU8_BMF-05      AEVQIARKLQCIADQFHRLHM---------QQEFPS----------WL--
A0A287AIU8_BMF-04      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A287AIU8_BMF-03      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A287AIU8_BMF-01      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A287AIU8_BMF-02      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A2K5KGR6_BMF-01      REQERGGPQVRLGCPLHMGHQ---------EHRQEGHR------AGLT--
A0A2K6FFR1_BMF-02      REQERGRSQ-----------------------------------------
M3WRS0_BMF-02          REQEWGRSQ-----------------------------------------
A0A2K5E1W9_BMF-02      REQEWGRPE-----------------------------------------
F7HPK0_BMF-02          REQEWGRPE-----------------------------------------
A0A2K6TW86_BMF-03      RKQEWGRSE-----------------------------------------
A0A2K6RAW8_BMF-02      RE------------------------------------------------
G3QIN5_BMF-02          REQERGRP------------------------------------------
Q96LC9_BMF-07          REQERGRP------------------------------------------
Q96LC9_BMF-05          REQERGRP------------------------------------------
A0A2R9BS98_BMF-02      REQERGRP------------------------------------------
A0A2J8QDD5_BMF-01      REQERGRP------------------------------------------
A0A2K5MJY6_BMF-01      REQERGGP------------------------------------------
G7PAW6_BMF-01          REQERGGP------------------------------------------
A0A2K6B5G4_BMF-03      REQERGGP------------------------------------------
A0A2K5Z4C3_BMF-02      REQERGGP------------------------------------------
A0A096NTE9_BMF-03      REQERGGP------------------------------------------
A0A2I3HD83_BMF-01      REQEWGRP------------------------------------------
A2AV74_BMF-01          AEVQIARKLQCIADQFHRLHT---------QQHQQNRD------RAWW--
Q8K589_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNRD------RAWR--
I3MDS9_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNRN------RVWW--
G3T7Z4_BMF-01          AEVQIARKLQCIADHFHRLHM---------QRHQQNRN------PAWR--
F6X3N6_BMF-01          AEVQIAQKLQCIADQFHRLHM---------QRHQQNRN------HVWW--
G3WDQ2_BMF-01          AEVQIARKLQCIADQFHRLHM---------QRHQQNQN------HVWW--
Q96LC9_BMF-06          AE------------------------------HQQNQN------RVWW--
F6TJI0_BMF-02          AEVQIARKLQCIADQFHRLHM---------QQHQQNRN------RVWW--
F6TJI0_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNRN------RVWW--
A0A286XXB0_BMF-02      AEVQIARKLQCIADQFHRLHI---------QQHQQNRN------RAWW--
J9PB65_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A286XXB0_BMF-01      AEVQIARKLQCIADQFHRLHI---------QQHQQNRN------RAWW--
G1SR62_BMF-01          AEVQIARKLQCIADQFHRLHL---------QQHQQNRN------RVWW--
W5QFV1_BMF-01          AEIQIARKLQCIADQFHRLHM---------QQHQQNRN------RMWW--
Q05KI3_BMF-01          AEIQIARKLQCIADQFHRLHM---------QQYQQNRN------RMWW--
Q05KI3_BMF-02          AEIQIARKLQCIADQFHRLHM---------QQYQQNRN------RMWW--
A0A452F2E0_BMF-02      AEIQIARKLQCIADQFHRLHM---------QQHQQNRN------RMWW--
A0A452F2E0_BMF-01      AEIQIARKLQCIADQFHRLHM---------QQHQQNRN------RMWW--
M3WRS0_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNRR------RVWW--
A0A2U4BC98_BMF-01      AEVQIARKLQRIADQFHRLHM---------QQHQQNRN------RVWW--
M3YAD5_BMF-01          AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A452SED0_BMF-01      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A384D070_BMF-01      AEVQIARKLQCIADQFHRLHM---------QQHQQNQN------RVWW--
A0A2K6FFR1_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RMWW--
H0WYH6_BMF-01          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
A0A096NTE9_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6L933_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A096NTE9_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K5MJY6_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K5KGR6_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
G7PAW6_BMF-02          AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
F7CM09_BMF-02          AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6B5G4_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6B5G4_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6B5G4_BMF-04      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K5Z4C3_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6L933_BMF-03      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6L933_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6RAW8_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A0D9R4R5_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RMWW--
F7HPK0_BMF-01          AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RMWW--
A0A2K5E1W9_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6TW86_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
A0A2K6TW86_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
G3QIN5_BMF-01          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
Q96LC9_BMF-01          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
Q96LC9_BMF-04          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
Q96LC9_BMF-03          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
Q96LC9_BMF-02          AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
A0A2R9BS98_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
A0A2J8QDD5_BMF-02      AEVQIARKLQCIADQFHRLHV---------QQHQQNQN------RVWW--
A0A2J8T301_BMF-01      AEVQIARKLQCIADQFHRLHV---------QQHQQNRN------RVWW--
H9GL49_BMF-01          TEVQIARKLQCIADQFHRLHL---------QRHQQNRN------QVWW--
K7FRX2_BMF-01          AEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
A9XRG9_BMF-01          TEVQIARKLQCIADQFHRLHI---------QRVGCFHR------GRWG--
A9XRG9_BMF-02          TEVQIARKLQCIADQFHRLHI---------QRVGCFHR------GRWG--
U3JS06_BMF-01          AEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
H0ZMX5_BMF-01          AEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
A9XRG9_BMF-03          TEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
A9XRG9_BMF-04          TEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
G1NHG8_BMF-01          TEVQIARKLQCIADQFHRLHI---------QRHQQNRN------QVWW--
A0A3B4UNJ0_BMF-01      VEAQIGRKLREIGDKFQQDHF---------MRHQRQNL------PAWM--
A0A3B4B6Y3_BMF-01      MEACIGHKLQLIGDQFHRDHLQRV------REH-----------------
Q0GKC7_BMF-01          VETLIGQKLQLIGDQFYQEHI---------MHHQRPQD------PLWR--
A0A3B3RH63_BMF-01      AEVRIGQKLQMIGDQFHQDQLQLY------HRNQRNQQ------PVWW--
W5N4P7_BMF-01          AEVRIGQKLQRIGDQFHRDYLHMY------RRNQRNHQ------PMWW--
A0A3B1K1X5_BMF-01      VEARIGQKLQMIGDQFYQEHMLQ-------HRNQRNQQ------PLWL--
A0A3B4CNJ8_BMF-01      VEARIGQKLQMIGDQFYQEHMLQ-------HRNQRNQQ------PFWL--
A0A2U9CJH3_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q2YCX7_BMF-01      IEACVGQKLQLIGDQFHREHLQLV------SRNQHKHK------------
A0A3Q2YCX7_BMF-02      IEACVGQKLQLIGDQFHREHLQLV------SRNQHKHK------------
A0A3P8ZIE7_BMF-01      VARCIGQKLQLIGDQFHEEHLQLY------HRNQRNLR------PLWW--
A0A3Q3QZ16_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q3QZ16_BMF-02      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q2PJX9_BMF-02      LEACIGQKLQLIGDQFHREHLQQR------GSFRSSLAAGEVGKPMYYTN
A0A3Q2PJX9_BMF-03      LEACIGQKLQLIGDQFHREHLQQY------HQNQRNQG------PLWW--
A0A3Q2PJX9_BMF-01      LEACIGQKLQLIGDQFHREHLQQY------HQNQRNQG------PLWW--
A0A3B5QK08_BMF-01      LEASIGQKLQLIGDQFHREHLQQY------QQNQRNQG------PLWW--
A0A3B5QK08_BMF-02      LEASIGQKLQLIGDQFHREHLQQY------QQNQRNQG------PLWW--
A0A096LRV0_BMF-01      LEACIGQKLQLIGDQFHREHLQQY------QQNQRNQG------PLWW--
A0A3B3WU80_BMF-01      LEACIGQKLQLIGDQFHREHLQQY------QQNQRNQG------PLWW--
A0A3P9Q8E2_BMF-01      LEACIGQKLQLIGDQFHREHLQQY------QQNQRNQG------PLWW--
A0A3Q2E3E8_BMF-02      LEACIGQKLQIIGDQFHREHLQQIPGQPFPHLVHQHQALTLPPLPVYF--
A0A3Q2E3E8_BMF-01      LEACIGQKLQIIGDQFHREHLQQY------HQNQRNQG------PLWW--
A0A3Q3GUU5_BMF-01      VEASIGLKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3B5B8F6_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3P8UA78_BMF-01      VEVRIGQKLQLIGDQFHRDHLQLY------HRNQRNHG------PLWW--
A0A3P8UA78_BMF-03      VEVRIGQKLQLIGDQFHRDHLQLY------HRNQRNHG------PLWW--
A0A3P8UA78_BMF-02      VEVRIGQKLQLIGDQFHRDHLQLY------HRNQRNHG------PLWW--
A0A3B3CGR9_BMF-01      TEACIAQKLQLIGDQFHRERLQLY------HQNQRNQG------PLWW--
A0A3B3I0V9_BMF-04      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3B3I0V9_BMF-02      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3B3I0V9_BMF-01      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3B3I0V9_BMF-03      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3P9JM16_BMF-03      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3P9JM16_BMF-02      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3P9JM16_BMF-01      TEACIAQKLQLIGDQFHRERLQLY------HRNQRNQG------PVWW--
A0A3Q2ZA20_BMF-01      LEVCIGQKLQLIGDQFHREHLQQY------HRNQRNQG------PLWW--
A0A3P8NFE2_BMF-02      VEACIGQKLQLIGDQFHWERLQLV------KASRIQT--------CWL--
I3K2D6_BMF-01          VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3P8NFE2_BMF-01      VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3Q3C5V2_BMF-01      VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3P9DPJ5_BMF-02      VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3P9DPJ5_BMF-01      VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3B4ETH0_BMF-01      VEACIGQKLQLIGDQFHWERLQLY------HRNQRNQG------PMWW--
A0A3Q4G1I4_BMF-01      VEACIGQKLQLIGDQFHWERLQLY------QRNQRNQG------PMWW--
A0A3Q1FVH7_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q1FVH7_BMF-02      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q1D1K3_BMF-01      MEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3P8RKY9_BMF-01      MEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3Q1IPR4_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HRNQRNQG------PLWW--
A0A3B4U5H8_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HQNQRNQG------PLWW--
A0A3B4WM88_BMF-01      VEACIGQKLQLIGDQFHREHLQLY------HQNQRNHG------PLWW--
A0A3Q3LME3_BMF-01      VEACIGQKLQLIGDQFHREHLQL--------------Q------VGWA--
A0A3Q3LME3_BMF-02      VEACIGQKLQLIGDQFHREHLQLY------HLNQRNQG------LLWW--
A0A3Q3LME3_BMF-03      VEACIGQKLQLIGDQFHREHLQLY------HLNQRNQG------LLWW--
A0A3Q3VLX6_BMF-01      VEACIGQKLQLIGDQFHREHMQLY------HRNQRNQG------PLWW--
A0A3B5KWG6_BMF-01      TEACIGQKLQLIGDQFHRERVQLY------QRNQRNQG------PLWW--
A9XRH0_BMF-01          ------------------------------QRHQQNRN------QVWW--
A3KND0_BMF-01          ------------------------------GKEALS--------------
                                                                         

F6TGJ4_BMF-01          ---------------QILIFF------RNLVMHPVGNRAGLAQR------
A0A452H3N6_BMF-01      ---------------QILLFI------HNLALNVEVNRNHVGQR------
G1PAU1_BMF-01          ---------------QFLLFL------HNLALNGDENRNGAGPR------
A2AV74_BMF-02          ---------------QVFLFL------QNLALNRQENREGVGPW------
A0A286XXB0_BMF-03      ---------------QVLLFM------HNLGLNGEENREGAGPR------
I3MDS9_BMF-02          ---------------QILLFL------HNLALNGDENRDRAGPR------
A0A287AIU8_BMF-05      ---------------G----------------------------------
A0A287AIU8_BMF-04      ---------------QILLFL------HNLALHGDENRNGAGPR------
A0A287AIU8_BMF-03      ---------------QILLFL------HNLALHGDENRNGAGPR------
A0A287AIU8_BMF-01      ---------------QILLFL------HNLALHGDENRNGAGPR------
A0A287AIU8_BMF-02      ---------------QILLFL------HNLALHGDENRNGAGPR------
A0A2K5KGR6_BMF-01      ---------------LCLVKL------FFCCYFAF---------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          ---------------QVFLFL------QNLALNRQENREGVGPW------
Q8K589_BMF-01          ---------------QVFLFL------QNLALNRRENREGVGPW------
I3MDS9_BMF-01          ---------------QILLFL------HNLALNGDENRDRAGPR------
G3T7Z4_BMF-01          ---------------QILQFL------HHLAVNGEENRNGAGPR------
F6X3N6_BMF-01          ---------------QILLFL------HNLALNREENRNGAGPR------
G3WDQ2_BMF-01          ---------------QILLFL------HNLALNREENRNGAGPR------
Q96LC9_BMF-06          ---------------QILLFL------HNLALNGEENRNGAGPR------
F6TJI0_BMF-02          ---------------QTLLFL------HNLALNGDENRNGAGPSFQPGQE
F6TJI0_BMF-01          ---------------QTLLFL------HNLALNGDENRNGAGPRCGKNVR
A0A286XXB0_BMF-02      ---------------QVLLFM------HNLGLNGEENREGAGPR------
J9PB65_BMF-01          ---------------QILLFL------HNLALNADENRNGAGPSFQLVPG
A0A286XXB0_BMF-01      ---------------QVLLFM------HNLGLNGEENREGAGPR------
G1SR62_BMF-01          ---------------QILLFL------HNLALNGDENRDGAGPR------
W5QFV1_BMF-01          ---------------QILLFL------HNVALNGDENRNGAGPR------
Q05KI3_BMF-01          ---------------QILLFL------HNVALNGDENRNGAGPR------
Q05KI3_BMF-02          ---------------QILLFL------HNVALNGDENRNGAGPR------
A0A452F2E0_BMF-02      ---------------QILLFL------HNVALNGDENRNGAGPR------
A0A452F2E0_BMF-01      ---------------QILLFL------HNVALNGDENRNGAGPR------
M3WRS0_BMF-01          ---------------QILLFL------HNLALNAEENRNGAGPR------
A0A2U4BC98_BMF-01      ---------------QILLFL------HNLALNGDENRNGAGPR------
M3YAD5_BMF-01          ---------------QILLFL------HNLALNADENRNGAGPR------
A0A452SED0_BMF-01      ---------------QILLFL------HNLALNADENRDGAGPR------
A0A384D070_BMF-01      ---------------QILLFL------HNLALNADENRDGAGPR------
A0A2K6FFR1_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
H0WYH6_BMF-01          ---------------QVLFFL------HNLALNGEENRNGAGPR------
A0A096NTE9_BMF-01      ---------------QILLFL------HNLALNGEENRNGVDPRYKNARR
A0A2K6L933_BMF-02      ---------------QILLFL------HNLALNGEENRNGAGPRPLTWNG
A0A096NTE9_BMF-02      ---------------QILLFL------HNLALNGEENRNGVDPRPLTWNG
A0A2K5MJY6_BMF-02      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K5KGR6_BMF-02      ---------------QILLFL------HNLALNGEENRNGAGPR------
G7PAW6_BMF-02          ---------------QILLFL------HNLALNGEENRNGAGPR------
F7CM09_BMF-02          ---------------QILLFL------HNLALNGEQNRNGAGPR------
A0A2K6B5G4_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K6B5G4_BMF-02      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K6B5G4_BMF-04      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K5Z4C3_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K6L933_BMF-03      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K6L933_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2K6RAW8_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A0D9R4R5_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
F7HPK0_BMF-01          ---------------QVLLFL------HNLALNGEENRNGAGPR------
A0A2K5E1W9_BMF-01      ---------------QVLLFL------HNLALNGEENRNGAGPR------
A0A2K6TW86_BMF-02      ---------------QVLLFL------HNLALNGEENRNGAGPR------
A0A2K6TW86_BMF-01      ---------------QVLLFL------HNLALNGEENRNGAGPR------
G3QIN5_BMF-01          ---------------QILLFL------HNLALNGEENRNGAGPR------
Q96LC9_BMF-01          ---------------QILLFL------HNLALNGEENRNGAGPR------
Q96LC9_BMF-04          ---------------QILLFL------HNLALNGEENRNGAGPR------
Q96LC9_BMF-03          ---------------QILLFL------HNLALNGEENRNGAGPR------
Q96LC9_BMF-02          ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2R9BS98_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2J8QDD5_BMF-02      ---------------QILLFL------HNLALNGEENRNGAGPR------
A0A2J8T301_BMF-01      ---------------QILLFL------HNLALNGEENRNGAGPR------
H9GL49_BMF-01          ---------------QIFFFL------HNVALNMEANRHRAGRSCTTTYF
K7FRX2_BMF-01          ---------------QILLFL------HNLALNVEANRNHIGQR------
A9XRG9_BMF-01          ---------------LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ-----
A9XRG9_BMF-02          ---------------LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ-----
U3JS06_BMF-01          ---------------QLFLFL------HNLALNTEVNRNHTGQR------
H0ZMX5_BMF-01          ---------------QLFLFL------HNLALNTEVNRNHTGQR------
A9XRG9_BMF-03          ---------------QLFLFL------HNLALNVEANRNRTGQR------
A9XRG9_BMF-04          ---------------QLFLFL------HNLALNVEANRNRTGQR------
G1NHG8_BMF-01          ---------------QLFLFL------HNLALNVEANRNRTGQR------
A0A3B4UNJ0_BMF-01      ---------------RLTMAL------FGFLFPRQALVPRLRGEQR----
A0A3B4B6Y3_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          ---------------RVATAV------LTLLFGA--------RENRR---
A0A3B3RH63_BMF-01      ---------------RLVMAL------CGLLFER------RQRAEQR---
W5N4P7_BMF-01          ---------------RLALAL------FTFLFERQGNRNQLRGDQR----
A0A3B1K1X5_BMF-01      ---------------RLASAL------YTLLFER-EPAAHGRREDRR---
A0A3B4CNJ8_BMF-01      ---------------RLASAL------YTLLFER-EPVANGRRVDQR---
A0A2U9CJH3_BMF-01      ---------------RLAAAL------LSLLFDR-GFLAGGGGAGRRQAH
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      ---------------RLASAL------LTLLWEQ-EAVAGGGRAGWR---
A0A3Q3QZ16_BMF-01      ---------------RLATTL------LSLLFDR-GFIAGGGGAGRR---
A0A3Q3QZ16_BMF-02      ---------------RLATTL------LSLLFDR-GFIAGGGGAGRR---
A0A3Q2PJX9_BMF-02      VYSQCPTCWLANCLSRLAAEL------LILCEFP-TLL------------
A0A3Q2PJX9_BMF-03      ---------------RMTAAL------LSLLLDR-GFVAGRGGAGRR---
A0A3Q2PJX9_BMF-01      ---------------RMTAAL------LSLLLDR-GFVAGRGGAGRR---
A0A3B5QK08_BMF-01      ---------------RMTAAL------LSLLFDR-GFIAGGGGAGRR---
A0A3B5QK08_BMF-02      ---------------RMTAAL------LSLLFDR-GFIAGGGGAGRR---
A0A096LRV0_BMF-01      ---------------RMTAAL------LSLLFHR-GFIAGGGGAGRR---
A0A3B3WU80_BMF-01      ---------------RMTAAL------LSLLFHR-GFIAGGGGAGRR---
A0A3P9Q8E2_BMF-01      ---------------RMTAAL------LSLLFDR-GFIAGGGGAGRR---
A0A3Q2E3E8_BMF-02      ---------------SLLSPV------VPL-------CCGGKWH------
A0A3Q2E3E8_BMF-01      ---------------RMTAAL------LSLLFDR-GLIGGAGWR------
A0A3Q3GUU5_BMF-01      ---------------RLGAAL------LSLLFDR-GFIA---GAGRR---
A0A3B5B8F6_BMF-01      ---------------RLAAAL------LSLLFDR-GFIAGGGGAGRR---
A0A3P8UA78_BMF-01      ---------------RLTTTL------LSLLFNR-GFFAGGGAAGRR---
A0A3P8UA78_BMF-03      ---------------RLTTTL------LSLLFNR-GFFAGGGAAGRR---
A0A3P8UA78_BMF-02      ---------------RLTTTL------LSLLFNR-GFFAGGGAAGRR---
A0A3B3CGR9_BMF-01      ---------------RLTTAL------VSLLLDR-GFIAGGGGAGQR---
A0A3B3I0V9_BMF-04      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQRQSV
A0A3B3I0V9_BMF-02      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3B3I0V9_BMF-01      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3B3I0V9_BMF-03      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3P9JM16_BMF-03      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3P9JM16_BMF-02      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3P9JM16_BMF-01      ---------------RLATAL------VSLLFDR-GFIAGAGGAGQR---
A0A3Q2ZA20_BMF-01      ---------------RLTAAL------LSLLFDR-GFIAGGGGAGRR---
A0A3P8NFE2_BMF-02      ---------------ETAEAY------ATPCKVHHSVITVWKPRGLSQWQ
I3K2D6_BMF-01          ---------------RLAAAL------LSLLFDR-GFIAGGGGGGRR---
A0A3P8NFE2_BMF-01      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3Q3C5V2_BMF-01      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3P9DPJ5_BMF-02      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3P9DPJ5_BMF-01      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3B4ETH0_BMF-01      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3Q4G1I4_BMF-01      ---------------RLAAAI------LSLLFDR-GFIAGGGGGGRR---
A0A3Q1FVH7_BMF-01      ---------------RLVAAI------LSLLFDG-GFIAGGGGAGRR---
A0A3Q1FVH7_BMF-02      ---------------RLVAAI------LSLLFDG-GFIAGGGGAGRR---
A0A3Q1D1K3_BMF-01      ---------------RLAAAV------LSLLFDR-GFIAGGGGAGRR---
A0A3P8RKY9_BMF-01      ---------------RLAAAV------LSLLFDR-GFIAGGGGAGRR---
A0A3Q1IPR4_BMF-01      ---------------RLAAAM------LSLLFDR-GLIAGGGGAGRR---
A0A3B4U5H8_BMF-01      ---------------RLAVAL------LSLLFDR-GLIAGGGGAGRR---
A0A3B4WM88_BMF-01      ---------------RLAAAL------LSLLFDR-GLIAGGGGAGRR---
A0A3Q3LME3_BMF-01      ---------------PETSGS------LPVLLACLTLITGVWREG-----
A0A3Q3LME3_BMF-02      ---------------RLATAL------LSLLFDR-GFIAGGGRAGRR---
A0A3Q3LME3_BMF-03      ---------------RLATAL------LSLLFDR-GFIAGGGRAGRRPPC
A0A3Q3VLX6_BMF-01      ---------------RLGSAL------LSLLFDR-GFFAGGGGAGRR---
A0A3B5KWG6_BMF-01      ---------------RLGTAL------LSLLFDR-GFVAGGGGAGRR---
A9XRH0_BMF-01          ---------------QLFLFL------HNLALNVEANRNRTGQR------
A3KND0_BMF-01          ---------------EIYRMF------NASIPHESHRFHRLFQV------
                                                                         

F6TGJ4_BMF-01          --------------------------------------------------
A0A452H3N6_BMF-01      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
I3MDS9_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-04      --------------------------------------------------
A0A287AIU8_BMF-03      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
I3MDS9_BMF-01          --------------------------------------------------
G3T7Z4_BMF-01          --------------------------------------------------
F6X3N6_BMF-01          --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
F6TJI0_BMF-02          GVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL-------------
F6TJI0_BMF-01          GPVRELETSDLFLSCHPELPPAPGFCQDFVLS--WS--------------
A0A286XXB0_BMF-02      --------------------------------------------------
J9PB65_BMF-01          ISCSGAQQDCSCL-------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
M3WRS0_BMF-01          --------------------------------------------------
A0A2U4BC98_BMF-01      --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      SVRKLKASSFLSCQPE----------------------------------
A0A2K6L933_BMF-02      GRCQTLLKGRLMCL------------------------------------
A0A096NTE9_BMF-02      AVVKPC--------------------------------------------
A0A2K5MJY6_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-02      --------------------------------------------------
G7PAW6_BMF-02          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5G4_BMF-01      --------------------------------------------------
A0A2K6B5G4_BMF-02      --------------------------------------------------
A0A2K6B5G4_BMF-04      --------------------------------------------------
A0A2K5Z4C3_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-03      --------------------------------------------------
A0A2K6L933_BMF-01      --------------------------------------------------
A0A2K6RAW8_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
F7HPK0_BMF-01          --------------------------------------------------
A0A2K5E1W9_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-02      --------------------------------------------------
A0A2K6TW86_BMF-01      --------------------------------------------------
G3QIN5_BMF-01          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
H9GL49_BMF-01          PFTEPPVCFPFSEMLPRFCLEAI---------------------------
K7FRX2_BMF-01          --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
A9XRG9_BMF-02          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A9XRG9_BMF-03          --------------------------------------------------
A9XRG9_BMF-04          --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      TKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2E3E8_BMF-02      --------------------------------------------------
A0A3Q2E3E8_BMF-01      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-04      VSD-----------------------------------------------
A0A3B3I0V9_BMF-02      --------------------------------------------------
A0A3B3I0V9_BMF-01      --------------------------------------------------
A0A3B3I0V9_BMF-03      --------------------------------------------------
A0A3P9JM16_BMF-03      --------------------------------------------------
A0A3P9JM16_BMF-02      --------------------------------------------------
A0A3P9JM16_BMF-01      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      FLTVN---------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3LME3_BMF-01      --------------------------------------------------
A0A3Q3LME3_BMF-02      --------------------------------------------------
A0A3Q3LME3_BMF-03      P-------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

© 1998-2019