Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

88 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
W5KM88_BMF-01          --------------------------------------------------
F6TGJ4_BMF-01          --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A1S3EQA2_BMF-02      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A287AIU8_BMF-03      --------------------------------------------------
A0A287AIU8_BMF-04      --------------------------------------------------
A0A1U8CPE0_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
I3MDS9_BMF-02          --------------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A1U7UD37_BMF-02      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
A0A286XXB0_BMF-02      MPGAGVFWKQYRARRR----------------------------------
I3MDS9_BMF-01          MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP------------
G3T7Z4_BMF-01          MPRAGVFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPPLPAELFPSFPI
F6X3N6_BMF-01          --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
A0A1S3WU31_BMF-01      --------------------------------------------------
J9PB65_BMF-01          --------------------------------------------------
A0A1U8CPE0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
F6TJI0_BMF-01          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
M3WRS0_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A2K6FFR1_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A1U7UD37_BMF-01      --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A2K5MJY6_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-02      --------------------------------------------------
G7PAW6_BMF-02          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5G4_BMF-02      --------------------------------------------------
A0A2K6B5G4_BMF-01      --------------------------------------------------
A0A2K6B5G4_BMF-04      --------------------------------------------------
A0A2K5Z4C3_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
F7HPK0_BMF-01          --------------------------------------------------
A0A2K5E1W9_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-02      --------------------------------------------------
G3QIN5_BMF-01          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A9XRG9_BMF-03          --------------------------------------------------
A9XRG9_BMF-02          --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
                                                                         

A9XRH0_BMF-01          ------------------------------------MDRPSY--------
A3KND0_BMF-01          --------------------------------------------------
W5KM88_BMF-01          ---------------------------MCAFVFVYTFSGQECPDVGKAKS
F6TGJ4_BMF-01          ------------------------------------QESYLN--------
G1PAU1_BMF-01          ------------------------------------MEPPQC--------
A0A1S3EQA2_BMF-02      -------------------------------IVPGEMEPPQC--------
A2AV74_BMF-02          -------------------------------MSPGEMEPPQC--------
A0A287AIU8_BMF-05      ------------------------------------MEPPQC--------
A0A287AIU8_BMF-01      ------------------------------------MEPPQC--------
A0A287AIU8_BMF-02      ------------------------------------MEPPQC--------
A0A287AIU8_BMF-03      ------------------------------------MEPPQC--------
A0A287AIU8_BMF-04      ------------------------------------MEPPQC--------
A0A1U8CPE0_BMF-02      -------------------------------IFPGEMEPPQC--------
A0A286XXB0_BMF-03      -------------------------------VFPREMEPPQC--------
I3MDS9_BMF-02          -------------------------------VFPEEMEPPQC--------
A0A2K5KGR6_BMF-01      ------------------------------------MEPSRC--------
A0A1U7UD37_BMF-02      ------------------------------------MDPSQC--------
A0A2K6FFR1_BMF-02      ------------------------------------MEPSHC--------
M3WRS0_BMF-02          ------------------------------------MEPPQC--------
A0A2K5E1W9_BMF-02      ------------------------------------MEPSQC--------
F7HPK0_BMF-02          ------------------------------------MEPSQC--------
A0A2K6TW86_BMF-03      ------------------------------------MEPSQC--------
A0A2K6RAW8_BMF-02      ------------------------------------MEPSRC--------
G3QIN5_BMF-02          ------------------------------------MEPSQC--------
A0A2R9BS98_BMF-02      ------------------------------------MEPSQC--------
A0A2J8QDD5_BMF-01      ------------------------------------MEPSQC--------
A0A2K5MJY6_BMF-01      ------------------------------------MEPSRC--------
G7PAW6_BMF-01          ------------------------------------MEPSRC--------
A0A2K6B5G4_BMF-03      ------------------------------------MEPSRC--------
A0A2K5Z4C3_BMF-02      ------------------------------------MEPSRC--------
A0A096NTE9_BMF-03      ------------------------------------MEPSRC--------
A0A2I3HD83_BMF-01      ------------------------------------MEPSQC--------
A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQC--------
A0A286XXB0_BMF-02      RRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQC--------
I3MDS9_BMF-01          GSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC--------
G3T7Z4_BMF-01          ESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQC--------
F6X3N6_BMF-01          ------------------------------------MEPPHY--------
G3WDQ2_BMF-01          ------------------------------------MESPHY--------
A0A1S3WU31_BMF-01      ------------------------------------MELPQC--------
J9PB65_BMF-01          ------------------------------------MEPPQC--------
A0A1U8CPE0_BMF-01      ------------------------------------MEPPQC--------
A0A286XXB0_BMF-01      ------------------------------------MEPPQC--------
G1SR62_BMF-01          ------------------------------------MEPPQC--------
F6TJI0_BMF-01          --------------------------------LTGDMEPPQC--------
Q05KI3_BMF-01          ------------------------------------MEPPQC--------
W5QFV1_BMF-01          --------------------------------LTGEMEPPQC--------
M3WRS0_BMF-01          ------------------------------------MEPPQC--------
M3YAD5_BMF-01          ------------------------------------MEPPQC--------
A0A2K6FFR1_BMF-01      ------------------------------------MEPSHC--------
H0WYH6_BMF-01          ------------------------------------MEPSQC--------
A0A1U7UD37_BMF-01      ------------------------------------MDPSQC--------
A0A096NTE9_BMF-01      ------------------------------------MEPSRC--------
A0A2K6L933_BMF-02      ------------------------------------MEPSRC--------
A0A096NTE9_BMF-02      ------------------------------------MEPSRC--------
A0A2K5MJY6_BMF-02      ------------------------------------MEPSRC--------
A0A2K5KGR6_BMF-02      ------------------------------------MEPSRC--------
G7PAW6_BMF-02          ------------------------------------MEPSRC--------
F7CM09_BMF-02          ------------------------------------MEPSRC--------
A0A2K6B5G4_BMF-02      ------------------------------------MEPSRC--------
A0A2K6B5G4_BMF-01      ------------------------------------MEPSRC--------
A0A2K6B5G4_BMF-04      ------------------------------------MEPSRC--------
A0A2K5Z4C3_BMF-01      ------------------------------------MEPSRC--------
A0A2K6L933_BMF-01      ------------------------------------MEPSRC--------
A0A2K6L933_BMF-03      ------------------------------------MEPSRC--------
A0A2K6RAW8_BMF-01      ------------------------------------MEPSRC--------
A0A0D9R4R5_BMF-01      ------------------------------------MEPSRC--------
F7HPK0_BMF-01          ------------------------------------MEPSQC--------
A0A2K5E1W9_BMF-01      ------------------------------------MEPSQC--------
A0A2K6TW86_BMF-01      ------------------------------------MEPSQC--------
A0A2K6TW86_BMF-02      ------------------------------------MEPSQC--------
G3QIN5_BMF-01          ------------------------------------MEPSQC--------
A0A2R9BS98_BMF-01      ------------------------------------MEPSQC--------
A0A2J8QDD5_BMF-02      ------------------------------------MEPSQC--------
A0A2J8T301_BMF-01      ------------------------------------MEPSQC--------
A0A1S3EQA2_BMF-01      ------------------------------------MEPPQC--------
Q8K589_BMF-01          ------------------------------------MEPPQC--------
H9GL49_BMF-01          ------------------------------------MDPPGY--------
A9XRG9_BMF-01          ------------------------------------MDRPSY--------
K7FRX2_BMF-01          ------------------------------------MDPPSY--------
U3JS06_BMF-01          ------------------------------------MDRPSY--------
H0ZMX5_BMF-01          ------------------------------------MDRPSY--------
A9XRG9_BMF-03          ------------------------------------MDRPSY--------
A9XRG9_BMF-02          ------------------------------------MDRPSY--------
G1NHG8_BMF-01          ------------------------------------MDRPSY--------
Q0GKC7_BMF-01          --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
                                                                         

A9XRH0_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDD--FGLAGNA
A3KND0_BMF-01          ----------------------------MDELDDDVFYPDA--FGYPDQT
W5KM88_BMF-01          YLFWTSNVGTKLRWGAWKALLMDD-------EEDDVFVTDPEP-------
F6TGJ4_BMF-01          ---------------------MDE-------LDDDVFYPD--EFGYPDQT
G1PAU1_BMF-01          ---------------------VEE-------LEDDVFQPED-ELGTQPGS
A0A1S3EQA2_BMF-02      ---------------------VEE-------LEDDVFQAEDGEPGTQPGS
A2AV74_BMF-02          ---------------------VEE-------LEDDVFQSEDGEPGTQPGG
A0A287AIU8_BMF-05      ---------------------VEE-------LEDDVFQPEEGEPGTQPRR
A0A287AIU8_BMF-01      ---------------------VEE-------LEDDVFQPEEGEPGTQPRR
A0A287AIU8_BMF-02      ---------------------VEE-------LEDDVFQPEEGEPGTQPRR
A0A287AIU8_BMF-03      ---------------------VEE-------LEDDVFQPEEGEPGTQPRR
A0A287AIU8_BMF-04      ---------------------VEE-------LEDDVFQPEEGEPGTQPRR
A0A1U8CPE0_BMF-02      ---------------------VEE-------LEDDVFQSEDGEPGTQPGS
A0A286XXB0_BMF-03      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
I3MDS9_BMF-02          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K5KGR6_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A1U7UD37_BMF-02      ---------------------VEE-------LEDDVFQPEDGESGTQSGS
A0A2K6FFR1_BMF-02      ---------------------VEE-------LEDDVFQPEDGESGTQPGS
M3WRS0_BMF-02          ---------------------VEE-------LEDDVFQPEDVEPGTQPGS
A0A2K5E1W9_BMF-02      ---------------------VEE-------LEDDVFQSEDGEPGTQPGS
F7HPK0_BMF-02          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K6TW86_BMF-03      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K6RAW8_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
G3QIN5_BMF-02          ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2R9BS98_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2J8QDD5_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2K5MJY6_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
G7PAW6_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGSQPGS
A0A2K6B5G4_BMF-03      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K5Z4C3_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A096NTE9_BMF-03      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2I3HD83_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A2AV74_BMF-01          ---------------------VEE-------LEDDVFQSEDGEPGTQPGG
A0A286XXB0_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
I3MDS9_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
G3T7Z4_BMF-01          ---------------------VEE-------LEDDVFQPEEGEPGTQPGG
F6X3N6_BMF-01          ---------------------VEE-------LEDDVFHPEDSEPGAQPGG
G3WDQ2_BMF-01          ---------------------VEE-------LEDDVFHPEDSEPGAQPGG
A0A1S3WU31_BMF-01      ---------------------VDE-------LEDDVFQPEDGEPGTTPGS
J9PB65_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A1U8CPE0_BMF-01      ---------------------VEE-------LEDDVFQSEDGEPGTQPGS
A0A286XXB0_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
G1SR62_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPQS
F6TJI0_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPRS
Q05KI3_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPRS
W5QFV1_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGAQPRR
M3WRS0_BMF-01          ---------------------VEE-------LEDDVFQPEDVEPGTQPGS
M3YAD5_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K6FFR1_BMF-01      ---------------------VEE-------LEDDVFQPEDGESGTQPGS
H0WYH6_BMF-01          ---------------------VEE-------LEDDVFQPEDGELGT--GN
A0A1U7UD37_BMF-01      ---------------------VEE-------LEDDVFQPEDGESGTQSGS
A0A096NTE9_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6L933_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A096NTE9_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K5MJY6_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K5KGR6_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
G7PAW6_BMF-02          ---------------------VEE-------LEDDVFQPEDGEPGSQPGS
F7CM09_BMF-02          ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6B5G4_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6B5G4_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6B5G4_BMF-04      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K5Z4C3_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6L933_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6L933_BMF-03      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A2K6RAW8_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
A0A0D9R4R5_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGAQPGS
F7HPK0_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K5E1W9_BMF-01      ---------------------VEE-------LEDDVFQSEDGEPGTQPGS
A0A2K6TW86_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
A0A2K6TW86_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
G3QIN5_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2R9BS98_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2J8QDD5_BMF-02      ---------------------VEE-------LEDDVFQPEDGEPVTQPGS
A0A2J8T301_BMF-01      ---------------------VEE-------LEDDVFQPEDGEPGTQSGS
A0A1S3EQA2_BMF-01      ---------------------VEE-------LEDDVFQAEDGEPGTQPGS
Q8K589_BMF-01          ---------------------VEE-------LEDDVFQPEDGEPGTQPGS
H9GL49_BMF-01          ---------------------LDDDFSTLDGLEDDVFHAEDCGLASQPSE
A9XRG9_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
K7FRX2_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDDFGLTGQPGE
U3JS06_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
H0ZMX5_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
A9XRG9_BMF-03          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
A9XRG9_BMF-02          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
G1NHG8_BMF-01          ---------------------LEEDYSSLDGLDDDVFHSDDFGLAGQPGE
Q0GKC7_BMF-01          ---------------------MDE-------DEDDVFRKG----------
W5N4P7_BMF-01          ---------------------MEE-------DEDDVFHPSH---------
I3K2D6_BMF-01          ---------------------MDD-------EEDDVFEPK----------
A0A096LRV0_BMF-01      ---------------------MED-------EEDDVFEPD----------
                                                       :****             

A9XRH0_BMF-01          -----------GY-----RLHVPPVGFALDPNLQ-EEPQEGQREART--E
A3KND0_BMF-01          ITSSSLFNQSQSYTCLLGRFHLFPFSHCCGPGCRGTDNEDKATQTLG--S
W5KM88_BMF-01          ------------WRSPISVIK----------------QEERGTQTPGRPP
F6TGJ4_BMF-01          MTSSTVFNQSQSYTCLLSRFHLFPLSHCCGPGCRGADYEDKATQTLGSPS
G1PAU1_BMF-01          LPSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A1S3EQA2_BMF-02      LLSATLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A2AV74_BMF-02          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A287AIU8_BMF-05      -VSADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A287AIU8_BMF-01      -VSADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A287AIU8_BMF-02      -VSADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A287AIU8_BMF-03      -VSADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A287AIU8_BMF-04      -VSADPFVQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A1U8CPE0_BMF-02      LLSADPFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A286XXB0_BMF-03      LLSADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSS
I3MDS9_BMF-02          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K5KGR6_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A1U7UD37_BMF-02      LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPAS
A0A2K6FFR1_BMF-02      VLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
M3WRS0_BMF-02          LLSANLFAQSQ-LDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K5E1W9_BMF-02      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
F7HPK0_BMF-02          LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K6TW86_BMF-03      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K6RAW8_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
G3QIN5_BMF-02          LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2R9BS98_BMF-02      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2J8QDD5_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K5MJY6_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
G7PAW6_BMF-01          SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6B5G4_BMF-03      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5Z4C3_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A096NTE9_BMF-03      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2I3HD83_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A2AV74_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A286XXB0_BMF-02      LLSADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSS
I3MDS9_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
G3T7Z4_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPAS
F6X3N6_BMF-01          LTSAALFAQSQ-PDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPAS
G3WDQ2_BMF-01          LTSPALFAQSQ-PDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPAS
A0A1S3WU31_BMF-01      LLSSDLFAQSP-MDCSLSRLQLFPLTHCCGPGLRPASQEDKATQTLSPAS
J9PB65_BMF-01          LLSADLFAQSQ-LDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A1U8CPE0_BMF-01      LLSADPFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPAS
A0A286XXB0_BMF-01      LLSADLFAQSQ-LDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSS
G1SR62_BMF-01          LLSADPFAQSQ-LDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPAS
F6TJI0_BMF-01          LLSADLFAPSQ-LDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPAS
Q05KI3_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
W5QFV1_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
M3WRS0_BMF-01          LLSANLFAQSQ-LDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
M3YAD5_BMF-01          LLSADLFAQSQ-LDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K6FFR1_BMF-01      VLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
H0WYH6_BMF-01          VLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A1U7UD37_BMF-01      LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPAS
A0A096NTE9_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6L933_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A096NTE9_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5MJY6_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5KGR6_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
G7PAW6_BMF-02          SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
F7CM09_BMF-02          SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6B5G4_BMF-02      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6B5G4_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6B5G4_BMF-04      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K5Z4C3_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6L933_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6L933_BMF-03      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A2K6RAW8_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
A0A0D9R4R5_BMF-01      SLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPAS
F7HPK0_BMF-01          LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K5E1W9_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K6TW86_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2K6TW86_BMF-02      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
G3QIN5_BMF-01          LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2R9BS98_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2J8QDD5_BMF-02      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A2J8T301_BMF-01      LLSADLFAQSL-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
A0A1S3EQA2_BMF-01      LLSATLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPAS
Q8K589_BMF-01          LLSADLFAQSQ-LDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTLSPAS
H9GL49_BMF-01          MTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQTLNPSS
A9XRG9_BMF-01          MTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSS
K7FRX2_BMF-01          MTPTGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSS
U3JS06_BMF-01          MTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSS
H0ZMX5_BMF-01          MTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSS
A9XRG9_BMF-03          MTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSS
A9XRG9_BMF-02          MTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSS
G1NHG8_BMF-01          MTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQTLSPSS
Q0GKC7_BMF-01          -------------------------LQHWPPPHLQIK----QTELAGRPA
W5N4P7_BMF-01          ------------------------FSHCWGTQFREIKYEDKGTQTPSPAL
I3K2D6_BMF-01          -------------------------ANCWRTTFREIKCEHRGTQTPGPAL
A0A096LRV0_BMF-01      -------------------------PNCWRTPFREIKCEDRGTQTPGPGQ
                                                                  :      

A9XRH0_BMF-01          VQIARKLQC-IADQFHRLHIQRH---------------------------
A3KND0_BMF-01          PSQDIMLPCGVSETPQRLFYGKE---------------------------
W5KM88_BMF-01          ARTNGMLPCGISEEPRRLFYGSA----------GLLLLA-PSARSERVG-
F6TGJ4_BMF-01          ISQDIMLPCGVSETPQRLFYGHA----------GYLLYL-PQNSP-----
G1PAU1_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A1S3EQA2_BMF-02      PSQGVMLPCGVTEEPQRLFYGSA----------GYRLPL-PAGFP-----
A2AV74_BMF-02          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A287AIU8_BMF-05      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PAGFP-----
A0A287AIU8_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PAGFP-----
A0A287AIU8_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PAGFP-----
A0A287AIU8_BMF-03      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PAGFP-----
A0A287AIU8_BMF-04      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PAGFP-----
A0A1U8CPE0_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A286XXB0_BMF-03      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
I3MDS9_BMF-02          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K5KGR6_BMF-01      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A0A1U7UD37_BMF-02      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSHV-VADTL-----
A0A2K6FFR1_BMF-02      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSHV-VADPP-----
M3WRS0_BMF-02          PSQGVMLPCGVTEEPQRLFYAPA----------KPPSSV-VADSP-----
A0A2K5E1W9_BMF-02      PSQGVMLPCGVTEEPQRLFYASA----------EPKSRV-VAGPP-----
F7HPK0_BMF-02          PSQGVMLPCGVTEEPQRLFYAPA----------EPKSHV-VAGPP-----
A0A2K6TW86_BMF-03      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSCV-VAGPP-----
A0A2K6RAW8_BMF-02      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
G3QIN5_BMF-02          PSQGVMLPCGVTEEPQRLFYAPA----------EPKSCV-VADPP-----
A0A2R9BS98_BMF-02      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSCV-VADPP-----
A0A2J8QDD5_BMF-01      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSCV-VADPP-----
A0A2K5MJY6_BMF-01      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
G7PAW6_BMF-01          PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A0A2K6B5G4_BMF-03      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A0A2K5Z4C3_BMF-02      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A0A096NTE9_BMF-03      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A0A2I3HD83_BMF-01      PSQGVMLPCGVTEEPQRLFYAPA----------EPKSRV-VADPP-----
A2AV74_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A286XXB0_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
I3MDS9_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
G3T7Z4_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
F6X3N6_BMF-01          PSQGVMLPCGVTEEPHRLFYGNA----------GYRLPL-PASFP-----
G3WDQ2_BMF-01          PSQGVMLPCGVTEEPHRLFYGNA----------GYRLPL-PANFP-----
A0A1S3WU31_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PNSFP-----
J9PB65_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A1U8CPE0_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A286XXB0_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
G1SR62_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
F6TJI0_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
Q05KI3_BMF-01          PSQGVMLPCGVTEEPQRLFYGHA----------GYRLPL-PASFP-----
W5QFV1_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
M3WRS0_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
M3YAD5_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6FFR1_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
H0WYH6_BMF-01          PSQGVMLPCGVTEEPQRLFYGNV----------GYRLPL-PASFP-----
A0A1U7UD37_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A096NTE9_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6L933_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A096NTE9_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K5MJY6_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K5KGR6_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
G7PAW6_BMF-02          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
F7CM09_BMF-02          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6B5G4_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6B5G4_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6B5G4_BMF-04      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K5Z4C3_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6L933_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6L933_BMF-03      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6RAW8_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A0D9R4R5_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
F7HPK0_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K5E1W9_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6TW86_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2K6TW86_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
G3QIN5_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2R9BS98_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2J8QDD5_BMF-02      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A2J8T301_BMF-01      PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
A0A1S3EQA2_BMF-01      PSQGVMLPCGVTEEPQRLFYGSA----------GYRLPL-PAGFP-----
Q8K589_BMF-01          PSQGVMLPCGVTEEPQRLFYGNA----------GYRLPL-PASFP-----
H9GL49_BMF-01          SSQDVMLPCGVTEEPQRLFYGNA----------GYRLHVSPIGFS-----
A9XRG9_BMF-01          SSQDVMLPCGVTEEPRRLFYGKSTPTSPAFQQGNYPFSTSPVRQF-----
K7FRX2_BMF-01          STQDVMLPCGVTEEPQRLFYGNA----------GYRLHEPPVGFA-----
U3JS06_BMF-01          SSQDVMLPCGVTEEPRRLFYGSA----------GYRLHVPPAGFV-----
H0ZMX5_BMF-01          SSQDVMLPCGVTEEPRRLFYGSA----------GYRLHVPPAGFV-----
A9XRG9_BMF-03          SSQDVMLPCGVTEEPRRLFYGNA----------GYRLHVPPVGFA-----
A9XRG9_BMF-02          SSQDVMLPCGVTEEPRRLFYGNA----------GYRLHVPPVGFA-----
G1NHG8_BMF-01          SSQDVMLPCGVTEEPRRLFYGNA----------GYRLHVPPVGFA-----
Q0GKC7_BMF-01          GSRNGMLLCRHLQQHGHFLYGNA----------ELLVLA-ASSRAQPPDV
W5N4P7_BMF-01          VHGDNMLPCGVGAEPRRLFYGNA----------AFRLHF-PAHFEQGGDE
I3K2D6_BMF-01          VPNNGMLPCGVAEEPRPLFYGNA----------GFRLHF-PARFELVGDH
A0A096LRV0_BMF-01      ALHNGMLPCGVAEEPRRLFYGNA----------GFRLHF-PAHFELVGDF
                             * *        :                                

A9XRH0_BMF-01          ------------------------Q-------------------------
A3KND0_BMF-01          ------------------------A-------------------------
W5KM88_BMF-01          --------DAMFREEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHML
F6TGJ4_BMF-01          ---------A--RFGEEVDNRRQ-E-QSAEHRIARKLQCIGDQFHRFHLQ
G1PAU1_BMF-01          ---------AGSPLGEQPPEGQW-QHHRAEIQIARKLQSIADQFHRLQMQ
A0A1S3EQA2_BMF-02      ---------A----AQQPPEG-----HRVEVQIARKLQCIADQFHRLHTQ
A2AV74_BMF-02          ---------AGSPLGEQPPEGQF-LQHRAEVQIARKLQCIADQFHRLHTQ
A0A287AIU8_BMF-05      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A287AIU8_BMF-01      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A287AIU8_BMF-02      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A287AIU8_BMF-03      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A287AIU8_BMF-04      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A1U8CPE0_BMF-02      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHIQ
A0A286XXB0_BMF-03      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHIQ
I3MDS9_BMF-02          ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A2K5KGR6_BMF-01      ---------L-------PAQPCF-E-WRREQERGGPQVRLGCPLHMGHQE
A0A1U7UD37_BMF-02      ---------L-------PTQPRF-E-WRREQERGRS--------------
A0A2K6FFR1_BMF-02      ---------L-------PTQPCF-E-RRREQERGRSQ-------------
M3WRS0_BMF-02          ---------L-------PTQPGF-E-CRREQEWGRSQ-------------
A0A2K5E1W9_BMF-02      ---------L-------SAQPGF-E-WRREQEWGRPE-------------
F7HPK0_BMF-02          ---------L-------PAQPGF-E-WRREQEWGRPE-------------
A0A2K6TW86_BMF-03      ---------L-------PAQPGF-E-WRRKQEWGRSE-------------
A0A2K6RAW8_BMF-02      ---------L-------PAQPCF-E-WRRE--------------------
G3QIN5_BMF-02          ---------L-------PAQPCF-E-WRREQERGRP--------------
A0A2R9BS98_BMF-02      ---------L-------PAQPCF-E-WRREQERGRP--------------
A0A2J8QDD5_BMF-01      ---------L-------PAQPCF-E-WRREQERGRP--------------
A0A2K5MJY6_BMF-01      ---------L-------PAQPCF-E-WRREQERGGP--------------
G7PAW6_BMF-01          ---------L-------PAQPCF-E-WRREQERGGP--------------
A0A2K6B5G4_BMF-03      ---------L-------PAQPCF-E-WRREQERGGP--------------
A0A2K5Z4C3_BMF-02      ---------L-------PAQPCF-E-WRREQERGGP--------------
A0A096NTE9_BMF-03      ---------L-------PAQPCF-E-WRREQERGGP--------------
A0A2I3HD83_BMF-01      ---------L-------PAQPCF-E-WRREQEWGRP--------------
A2AV74_BMF-01          ---------AGSPLGEQPPEGQFLQ-HRAEVQIARKLQCIADQFHRLHTQ
A0A286XXB0_BMF-02      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHIQ
I3MDS9_BMF-01          ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
G3T7Z4_BMF-01          ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADHFHRLHMQ
F6X3N6_BMF-01          ---------ASLRLGEEPPEEQW-E-HRAEVQIAQKLQCIADQFHRLHMQ
G3WDQ2_BMF-01          ---------SSLRLGAEPPEEQW-E-HRAEVQIARKLQCIADQFHRLHMQ
A0A1S3WU31_BMF-01      ---------AGSPFAEQRREGQW-Q-QRVEVQIARKLQCIADQFHHLHMQ
J9PB65_BMF-01          ---------AGLPLLEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A1U8CPE0_BMF-01      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHIQ
A0A286XXB0_BMF-01      ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHIQ
G1SR62_BMF-01          ---------ANFALGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHLQ
F6TJI0_BMF-01          ---------AGLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
Q05KI3_BMF-01          ---------AGLPLGEQPPEGQW-Q-HRAEIQIARKLQCIADQFHRLHMQ
W5QFV1_BMF-01          ---------AGLPLGEQPPEGQW-Q-HRAEIQIARKLQCIADQFHRLHMQ
M3WRS0_BMF-01          ---------AGLPLGEQPPEGHW-Q-HRAEVQIARKLQCIADQFHRLHMQ
M3YAD5_BMF-01          ---------AGLPLGDQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHMQ
A0A2K6FFR1_BMF-01      ---------AGLPLGEQPAEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
H0WYH6_BMF-01          ---------AGLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A1U7UD37_BMF-01      ---------AGLPFGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A096NTE9_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6L933_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A096NTE9_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K5MJY6_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K5KGR6_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
G7PAW6_BMF-02          ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
F7CM09_BMF-02          ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6B5G4_BMF-04      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K5Z4C3_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6L933_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6L933_BMF-03      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6RAW8_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A0D9R4R5_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
F7HPK0_BMF-01          ---------AVLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K5E1W9_BMF-01      ---------AVLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6TW86_BMF-01      ---------AVLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2K6TW86_BMF-02      ---------AVLPLGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
G3QIN5_BMF-01          ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2R9BS98_BMF-01      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2J8QDD5_BMF-02      ---------AVLPIGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A2J8T301_BMF-01      ---------AVLPTGEQPPEGQW-Q-HRAEVQIARKLQCIADQFHRLHVQ
A0A1S3EQA2_BMF-01      ---------A----AQQPPEG-----HRVEVQIARKLQCIADQFHRLHTQ
Q8K589_BMF-01          ---------AGSALGEQPPEGQF-LQHRAEVQIARKLQCIADQFHRLHMQ
H9GL49_BMF-01          ---------LNPHFQEEPQESPQ-E-LRTEVQIARKLQCIADQFHRLHLQ
A9XRG9_BMF-01          ---------LSLKL------------------------------------
K7FRX2_BMF-01          ---------LNPHLQEEPREGHQ-E-ARAEVQIARKLQCIADQFHRLHIQ
U3JS06_BMF-01          ---------LDPHLQEEPQEGQR-E-ARAEVQIARKLQCIADQFHRLHIQ
H0ZMX5_BMF-01          ---------LDPHLQEEPQEGQR-E-ARAEVQIARKLQCIADQFHRLHIQ
A9XRG9_BMF-03          ---------LDPNLQEEPQEGQR-E-ARTEVQIARKLQCIADQFHRLHIQ
A9XRG9_BMF-02          ---------LDPNLQEEPQEGQR-E-ARTEVQIARKLQCIADQFHRLHIQ
G1NHG8_BMF-01          ---------LDPNLQEEPQEGQR-E-ARTEVQIARKLQCIADQFHRLHIQ
Q0GKC7_BMF-01          VLRQNV--SPMERPEPRP------A-QSVETLIGQKLQLIGDQFYQEHIM
W5N4P7_BMF-01          E-------EETGEAEEQP------V-RSAEVRIGQKLQRIGDQFHRDYLH
I3K2D6_BMF-01          RARRQEIAEQQNSMERLPRQRPA-A-RSVEACIGQKLQLIGDQFHWERLQ
A0A096LRV0_BMF-01      DARQQ---EEQNRMEQLPLHQPA-A-LSLEACIGQKLQLIGDQFHREHLQ
                                                                         

A9XRH0_BMF-01          ------QNRNQVWWQLFLFLHNLALNVEANRNRTGQR-------------
A3KND0_BMF-01          ------LS------EIYRMFNASIPHESHRFHRLFQV-------------
W5KM88_BMF-01          QHRNQ-RNQQPLWLRLASALYTLLFEREPAAHGRREDRR-----------
F6TGJ4_BMF-01          RLQQN-RNQ--FWSQILIFFRNLVMHPVGNRAGLAQR-------------
G1PAU1_BMF-01          QHQQN-RNR--MWWQFLLFLHNLALNGDENRNGAGPR-------------
A0A1S3EQA2_BMF-02      RHQQH-RDR--AWGQVLLFLHNLALNR-ENRDRAGPR-------------
A2AV74_BMF-02          QHQQN-RDR--AWWQVFLFLQNLALNRQENREGVGPW-------------
A0A287AIU8_BMF-05      QEFPS-------WLG-----------------------------------
A0A287AIU8_BMF-01      QHQQN-QNR--VWWQILLFLHNLALHGDENRNGAGPR-------------
A0A287AIU8_BMF-02      QHQQN-QNR--VWWQILLFLHNLALHGDENRNGAGPR-------------
A0A287AIU8_BMF-03      QHQQN-QNR--VWWQILLFLHNLALHGDENRNGAGPR-------------
A0A287AIU8_BMF-04      QHQQN-QNR--VWWQILLFLHNLALHGDENRNGAGPR-------------
A0A1U8CPE0_BMF-02      QHQQN-RDR--AWWQVFLFLQNLALNREENREGVGPW-------------
A0A286XXB0_BMF-03      QHQQN-RNR--AWWQVLLFMHNLGLNGEENREGAGPR-------------
I3MDS9_BMF-02          QHQQN-RNR--VWWQILLFLHNLALNGDENRDRAGPR-------------
A0A2K5KGR6_BMF-01      HRQEG-HRA--GLTLCLVKLFFCCYFAF----------------------
A0A1U7UD37_BMF-02      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A2AV74_BMF-01          QHQQN-RDR--AWWQVFLFLQNLALNRQENREGVGPW-------------
A0A286XXB0_BMF-02      QHQQN-RNR--AWWQVLLFMHNLGLNGEENREGAGPR-------------
I3MDS9_BMF-01          QHQQN-RNR--VWWQILLFLHNLALNGDENRDRAGPR-------------
G3T7Z4_BMF-01          RHQQN-RNP--AWRQILQFLHHLAVNGEENRNGAGPR-------------
F6X3N6_BMF-01          RHQQN-RNH--VWWQILLFLHNLALNREENRNGAGPR-------------
G3WDQ2_BMF-01          RHQQN-QNH--VWWQILLFLHNLALNREENRNGAGPR-------------
A0A1S3WU31_BMF-01      QHQQN-RNP--VWWPFLLFLHNLALNEGENRNREAPR-------------
J9PB65_BMF-01          QHQQN-QNR--VWWQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQ
A0A1U8CPE0_BMF-01      QHQQN-RDR--AWWQVFLFLQNLALNREENREGVGPW-------------
A0A286XXB0_BMF-01      QHQQN-RNR--AWWQVLLFMHNLGLNGEENREGAGPR-------------
G1SR62_BMF-01          QHQQN-RNR--VWWQILLFLHNLALNGDENRDGAGPR-------------
F6TJI0_BMF-01          QHQQN-RNR--VWWQTLLFLHNLALNGDENRNGAGPR-------------
Q05KI3_BMF-01          QYQQN-RNR--MWWQILLFLHNVALNGDENRNGAGPR-------------
W5QFV1_BMF-01          QHQQN-RNR--MWWQILLFLHNVALNGDENRNGAGPR-------------
M3WRS0_BMF-01          QHQQN-RRR--VWWQILLFLHNLALNAEENRNGAGPR-------------
M3YAD5_BMF-01          QHQQN-QNR--VWWQILLFLHNLALNADENRNGAGPR-------------
A0A2K6FFR1_BMF-01      QHQQN-QNR--MWWQILLFLHNLALNGEENRNGAGPR-------------
H0WYH6_BMF-01          QHQQN-QNR--VWWQVLFFLHNLALNGEENRNGAGPR-------------
A0A1U7UD37_BMF-01      QHQQN-RNR--MWWQILFFLHNLALNGEENRNGAGPR-------------
A0A096NTE9_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKA
A0A2K6L933_BMF-02      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLL
A0A096NTE9_BMF-02      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGVDPRPLTWNGAVVKPC-
A0A2K5MJY6_BMF-02      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K5KGR6_BMF-02      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
G7PAW6_BMF-02          QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
F7CM09_BMF-02          QHQQN-RNR--VWWQILLFLHNLALNGEQNRNGAGPR-------------
A0A2K6B5G4_BMF-02      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K6B5G4_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K6B5G4_BMF-04      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K5Z4C3_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K6L933_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K6L933_BMF-03      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2K6RAW8_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A0D9R4R5_BMF-01      QHQQN-RNR--MWWQILLFLHNLALNGEENRNGAGPR-------------
F7HPK0_BMF-01          QHQQN-RNR--MWWQVLLFLHNLALNGEENRNGAGPR-------------
A0A2K5E1W9_BMF-01      QHQQN-RNR--VWWQVLLFLHNLALNGEENRNGAGPR-------------
A0A2K6TW86_BMF-01      QHQQN-RNR--VWWQVLLFLHNLALNGEENRNGAGPR-------------
A0A2K6TW86_BMF-02      QHQQN-RNR--VWWQVLLFLHNLALNGEENRNGAGPR-------------
G3QIN5_BMF-01          QHQQN-QNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2R9BS98_BMF-01      QHQQN-QNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2J8QDD5_BMF-02      QHQQN-QNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A2J8T301_BMF-01      QHQQN-RNR--VWWQILLFLHNLALNGEENRNGAGPR-------------
A0A1S3EQA2_BMF-01      RHQQH-RDR--AWGQVLLFLHNLALN-RENRDRAGPR-------------
Q8K589_BMF-01          QHQQN-RDR--AWRQVFLFLQNLALNRRENREGVGPW-------------
H9GL49_BMF-01          RHQQN-RNQ--VWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPV
A9XRG9_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          RHQQN-RNQ--VWWQILLFLHNLALNVEANRNHIGQR-------------
U3JS06_BMF-01          RHQQN-RNQ--VWWQLFLFLHNLALNTEVNRNHTGQR-------------
H0ZMX5_BMF-01          RHQQN-RNQ--VWWQLFLFLHNLALNTEVNRNHTGQR-------------
A9XRG9_BMF-03          RHQQN-RNQ--VWWQLFLFLHNLALNVEANRNRTGQR-------------
A9XRG9_BMF-02          RHQQN-RNQ--VWWQLFLFLHNLALNVEANRNRTGQR-------------
G1NHG8_BMF-01          RHQQN-RNQ--VWWQLFLFLHNLALNVEANRNRTGQR-------------
Q0GKC7_BMF-01          ---HHQRPQDPLWRRVATAVLTLLF-------GARENRR-----------
W5N4P7_BMF-01          MYRRNQRNHQPMWWRLALALFTFLFERQGNRNQLRGDQR-----------
I3K2D6_BMF-01          LYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGGGRR-----------
A0A096LRV0_BMF-01      QYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR-----------
                                                                         

A9XRH0_BMF-01          ----------------
A3KND0_BMF-01          ----------------
W5KM88_BMF-01          ----------------
F6TGJ4_BMF-01          ----------------
G1PAU1_BMF-01          ----------------
A0A1S3EQA2_BMF-02      ----------------
A2AV74_BMF-02          ----------------
A0A287AIU8_BMF-05      ----------------
A0A287AIU8_BMF-01      ----------------
A0A287AIU8_BMF-02      ----------------
A0A287AIU8_BMF-03      ----------------
A0A287AIU8_BMF-04      ----------------
A0A1U8CPE0_BMF-02      ----------------
A0A286XXB0_BMF-03      ----------------
I3MDS9_BMF-02          ----------------
A0A2K5KGR6_BMF-01      ----------------
A0A1U7UD37_BMF-02      ----------------
A0A2K6FFR1_BMF-02      ----------------
M3WRS0_BMF-02          ----------------
A0A2K5E1W9_BMF-02      ----------------
F7HPK0_BMF-02          ----------------
A0A2K6TW86_BMF-03      ----------------
A0A2K6RAW8_BMF-02      ----------------
G3QIN5_BMF-02          ----------------
A0A2R9BS98_BMF-02      ----------------
A0A2J8QDD5_BMF-01      ----------------
A0A2K5MJY6_BMF-01      ----------------
G7PAW6_BMF-01          ----------------
A0A2K6B5G4_BMF-03      ----------------
A0A2K5Z4C3_BMF-02      ----------------
A0A096NTE9_BMF-03      ----------------
A0A2I3HD83_BMF-01      ----------------
A2AV74_BMF-01          ----------------
A0A286XXB0_BMF-02      ----------------
I3MDS9_BMF-01          ----------------
G3T7Z4_BMF-01          ----------------
F6X3N6_BMF-01          ----------------
G3WDQ2_BMF-01          ----------------
A0A1S3WU31_BMF-01      ----------------
J9PB65_BMF-01          QDCSCL----------
A0A1U8CPE0_BMF-01      ----------------
A0A286XXB0_BMF-01      ----------------
G1SR62_BMF-01          ----------------
F6TJI0_BMF-01          ----------------
Q05KI3_BMF-01          ----------------
W5QFV1_BMF-01          ----------------
M3WRS0_BMF-01          ----------------
M3YAD5_BMF-01          ----------------
A0A2K6FFR1_BMF-01      ----------------
H0WYH6_BMF-01          ----------------
A0A1U7UD37_BMF-01      ----------------
A0A096NTE9_BMF-01      SSFLSCQPE-------
A0A2K6L933_BMF-02      KGRLMCL---------
A0A096NTE9_BMF-02      ----------------
A0A2K5MJY6_BMF-02      ----------------
A0A2K5KGR6_BMF-02      ----------------
G7PAW6_BMF-02          ----------------
F7CM09_BMF-02          ----------------
A0A2K6B5G4_BMF-02      ----------------
A0A2K6B5G4_BMF-01      ----------------
A0A2K6B5G4_BMF-04      ----------------
A0A2K5Z4C3_BMF-01      ----------------
A0A2K6L933_BMF-01      ----------------
A0A2K6L933_BMF-03      ----------------
A0A2K6RAW8_BMF-01      ----------------
A0A0D9R4R5_BMF-01      ----------------
F7HPK0_BMF-01          ----------------
A0A2K5E1W9_BMF-01      ----------------
A0A2K6TW86_BMF-01      ----------------
A0A2K6TW86_BMF-02      ----------------
G3QIN5_BMF-01          ----------------
A0A2R9BS98_BMF-01      ----------------
A0A2J8QDD5_BMF-02      ----------------
A0A2J8T301_BMF-01      ----------------
A0A1S3EQA2_BMF-01      ----------------
Q8K589_BMF-01          ----------------
H9GL49_BMF-01          CFPFSEMLPRFCLEAI
A9XRG9_BMF-01          ----------------
K7FRX2_BMF-01          ----------------
U3JS06_BMF-01          ----------------
H0ZMX5_BMF-01          ----------------
A9XRG9_BMF-03          ----------------
A9XRG9_BMF-02          ----------------
G1NHG8_BMF-01          ----------------
Q0GKC7_BMF-01          ----------------
W5N4P7_BMF-01          ----------------
I3K2D6_BMF-01          ----------------
A0A096LRV0_BMF-01      ----------------
                                       

© 1998-2018