Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

93 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q0GKC7_BMF-01          --------------------------------------------------
F6TGJ4_BMF-01          --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A1U8CPE0_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
I3MDS9_BMF-02          --------------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-03      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A287AIU8_BMF-04      --------------------------------------------------
A0A1S3EQA2_BMF-02      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
I3MDS9_BMF-01          MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLP------------
G3T7Z4_BMF-01          MPRAGVFWKQYRTVLSLVHQRPPALAAAA--VRSPRLPPLPAELFPSFPI
F6X3N6_BMF-01          --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
A0A1S3WU31_BMF-01      --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
A0A286XXB0_BMF-02      ----------------------------------MPGAGVFWKQYRARRR
J9PB65_BMF-01          --------------------------------------------------
A0A1U8CPE0_BMF-01      --------------------------------------------------
A0A286XXB0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
F6TJI0_BMF-01          --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
M3WRS0_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
A0A2K6FFR1_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-02      --------------------------------------------------
A0A2K5MJY6_BMF-02      --------------------------------------------------
A0A2K5KGR6_BMF-02      --------------------------------------------------
G7PAW6_BMF-02          --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
A0A2K6B5G4_BMF-02      --------------------------------------------------
A0A2K6B5G4_BMF-01      --------------------------------------------------
A0A2K6B5G4_BMF-04      --------------------------------------------------
A0A2K5Z4C3_BMF-01      --------------------------------------------------
A0A2K6L933_BMF-03      --------------------------------------------------
A0A2K6L933_BMF-01      --------------------------------------------------
A0A2K6RAW8_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
F7HPK0_BMF-01          --------------------------------------------------
A0A2K5E1W9_BMF-01      --------------------------------------------------
A0A2K6TW86_BMF-02      --------------------------------------------------
A0A2K6TW86_BMF-01      --------------------------------------------------
G3QIN5_BMF-01          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A9XRG9_BMF-02          --------------------------------------------------
A9XRG9_BMF-03          --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

Q0GKC7_BMF-01          ------------------------------------------MDE-----
F6TGJ4_BMF-01          ------------------------------------QESYLNMDE-----
G1PAU1_BMF-01          ------------------------------------MEPPQCVEE-----
A0A1U8CPE0_BMF-02      -------------------------------IFPGEMEPPQCVEE-----
A0A286XXB0_BMF-03      -------------------------------VFPREMEPPQCVEE-----
I3MDS9_BMF-02          -------------------------------VFPEEMEPPQCVEE-----
A0A287AIU8_BMF-05      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-03      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-01      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-02      ------------------------------------MEPPQCVEE-----
A0A287AIU8_BMF-04      ------------------------------------MEPPQCVEE-----
A0A1S3EQA2_BMF-02      -------------------------------IVPGEMEPPQCVEE-----
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEE-----
H9GL49_BMF-01          ------------------------------------MDPPGYLDDDFSTL
A0A2K5KGR6_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6FFR1_BMF-02      ------------------------------------MEPSHCVEE-----
M3WRS0_BMF-02          ------------------------------------MEPPQCVEE-----
A0A2K5E1W9_BMF-02      ------------------------------------MEPSQCVEE-----
F7HPK0_BMF-02          ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-03      ------------------------------------MEPSQCVEE-----
A0A2K6RAW8_BMF-02      ------------------------------------MEPSRCVEE-----
G3QIN5_BMF-02          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-07          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-05          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K5MJY6_BMF-01      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-01          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2I3HD83_BMF-01      ------------------------------------MEPSQCVEE-----
A0A1S3EQA2_BMF-01      ------------------------------------MEPPQCVEE-----
Q8K589_BMF-01          ------------------------------------MEPPQCVEE-----
A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEE-----
I3MDS9_BMF-01          GSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEE-----
G3T7Z4_BMF-01          ESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQCVEE-----
F6X3N6_BMF-01          ------------------------------------MEPPHYVEE-----
G3WDQ2_BMF-01          ------------------------------------MESPHYVEE-----
A0A1S3WU31_BMF-01      ------------------------------------MELPQCVDE-----
Q96LC9_BMF-06          ------------------------------------MEPSQCVEE-----
A0A286XXB0_BMF-02      RRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEE-----
J9PB65_BMF-01          ------------------------------------MEPPQCVEE-----
A0A1U8CPE0_BMF-01      ------------------------------------MEPPQCVEE-----
A0A286XXB0_BMF-01      ------------------------------------MEPPQCVEE-----
G1SR62_BMF-01          ------------------------------------MEPPQCVEE-----
F6TJI0_BMF-01          --------------------------------LTGDMEPPQCVEE-----
Q05KI3_BMF-01          ------------------------------------MEPPQCVEE-----
W5QFV1_BMF-01          --------------------------------LTGEMEPPQCVEE-----
M3WRS0_BMF-01          ------------------------------------MEPPQCVEE-----
M3YAD5_BMF-01          ------------------------------------MEPPQCVEE-----
A0A2K6FFR1_BMF-01      ------------------------------------MEPSHCVEE-----
H0WYH6_BMF-01          ------------------------------------MEPSQCVEE-----
A0A096NTE9_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-02      ------------------------------------MEPSRCVEE-----
A0A096NTE9_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5MJY6_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K5KGR6_BMF-02      ------------------------------------MEPSRCVEE-----
G7PAW6_BMF-02          ------------------------------------MEPSRCVEE-----
F7CM09_BMF-02          ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-02      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6B5G4_BMF-04      ------------------------------------MEPSRCVEE-----
A0A2K5Z4C3_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-03      ------------------------------------MEPSRCVEE-----
A0A2K6L933_BMF-01      ------------------------------------MEPSRCVEE-----
A0A2K6RAW8_BMF-01      ------------------------------------MEPSRCVEE-----
A0A0D9R4R5_BMF-01      ------------------------------------MEPSRCVEE-----
F7HPK0_BMF-01          ------------------------------------MEPSQCVEE-----
A0A2K5E1W9_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2K6TW86_BMF-01      ------------------------------------MEPSQCVEE-----
G3QIN5_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-01          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-02          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-03          ------------------------------------MEPSQCVEE-----
Q96LC9_BMF-04          ------------------------------------MEPSQCVEE-----
A0A2R9BS98_BMF-01      ------------------------------------MEPSQCVEE-----
A0A2J8QDD5_BMF-02      ------------------------------------MEPSQCVEE-----
A0A2J8T301_BMF-01      ------------------------------------MEPSQCVEE-----
A9XRG9_BMF-01          ------------------------------------MDRPSYLEEDYSSL
K7FRX2_BMF-01          ------------------------------------MDPPSYLEEDYSSL
U3JS06_BMF-01          ------------------------------------MDRPSYLEEDYSSL
H0ZMX5_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-02          ------------------------------------MDRPSYLEEDYSSL
A9XRG9_BMF-03          ------------------------------------MDRPSYLEEDYSSL
G1NHG8_BMF-01          ------------------------------------MDRPSYLEEDYSSL
W5N4P7_BMF-01          ------------------------------------------MEE-----
I3K2D6_BMF-01          ------------------------------------------MDD-----
A0A096LRV0_BMF-01      ------------------------------------------MED-----
A0A2U9CJH3_BMF-01      ------------------------------------------MDD-----
A9XRH0_BMF-01          ------------------------------------MDRPSYLEEDYSSL
A3KND0_BMF-01          -------------------------------------------------M
                                                                         

Q0GKC7_BMF-01          --DEDDVFRKG-----------------------------LQHWP-----
F6TGJ4_BMF-01          --LDDDVFYPD--EFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCC
G1PAU1_BMF-01          --LEDDVFQPED-ELGTQPGSLPSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A1U8CPE0_BMF-02      --LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQLFPLTHCC
A0A286XXB0_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
I3MDS9_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-05      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-03      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-01      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-02      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A287AIU8_BMF-04      --LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQLFPLTHCC
A0A1S3EQA2_BMF-02      --LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQLFPLTHCC
A2AV74_BMF-02          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
H9GL49_BMF-01          DGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCC
A0A2K5KGR6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6FFR1_BMF-02      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-02          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
A0A2K5E1W9_BMF-02      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-02          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-03      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-07          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-05          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-01          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2I3HD83_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A1S3EQA2_BMF-01      --LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQLFPLTHCC
Q8K589_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A2AV74_BMF-01          --LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
I3MDS9_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
G3T7Z4_BMF-01          --LEDDVFQPEEGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
F6X3N6_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSAALFAQSQ-PDYMLDGLQLFPLTHCC
G3WDQ2_BMF-01          --LEDDVFHPEDSEPGAQPGGLTSPALFAQSQ-PDYMLDGLQLFPLTHCC
A0A1S3WU31_BMF-01      --LEDDVFQPEDGEPGTTPGSLLSSDLFAQSP-MDCSLSRLQLFPLTHCC
Q96LC9_BMF-06          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A286XXB0_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
J9PB65_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A1U8CPE0_BMF-01      --LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQLFPLTHCC
A0A286XXB0_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLHLFPLTHCC
G1SR62_BMF-01          --LEDDVFQPEDGEPGTQPQSLLSADPFAQSQ-LDCPLGRLHLFPLTHCC
F6TJI0_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLRLFPLTHCC
Q05KI3_BMF-01          --LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
W5QFV1_BMF-01          --LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQLFPLTHCC
M3WRS0_BMF-01          --LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQLFPLTHCC
M3YAD5_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLHLFPLTHCC
A0A2K6FFR1_BMF-01      --LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
H0WYH6_BMF-01          --LEDDVFQPEDGELGT--GNVLSADLFAQSQ-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A096NTE9_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5MJY6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5KGR6_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
G7PAW6_BMF-02          --LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7CM09_BMF-02          --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-02      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6B5G4_BMF-04      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5Z4C3_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-03      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6L933_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6RAW8_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A0D9R4R5_BMF-01      --LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQLFPLTHCC
F7HPK0_BMF-01          --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K5E1W9_BMF-01      --LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-02      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2K6TW86_BMF-01      --LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
G3QIN5_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-01          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-02          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-03          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
Q96LC9_BMF-04          --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2R9BS98_BMF-01      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8QDD5_BMF-02      --LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A0A2J8T301_BMF-01      --LEDDVFQPEDGEPGTQSGSLLSADLFAQSL-LDCPLSRLQLFPLTHCC
A9XRG9_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
K7FRX2_BMF-01          DGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCC
U3JS06_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
H0ZMX5_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-02          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
A9XRG9_BMF-03          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
G1NHG8_BMF-01          DGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCC
W5N4P7_BMF-01          --DEDDVFHPSH---------------------------------FSHCW
I3K2D6_BMF-01          --EEDDVFEPK-----------------------------------ANCW
A0A096LRV0_BMF-01      --EEDDVFEPD-----------------------------------PNCW
A0A2U9CJH3_BMF-01      --EEDDVFEPD-----------------------------------PHCW
A9XRH0_BMF-01          DGLDDDVFHSDD--FGLAGNA-----------GY-----RLHVPPVGFAL
A3KND0_BMF-01          DELDDDVFYPDA--FGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCC
                          :****                                          

Q0GKC7_BMF-01          -----PPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNA------
F6TGJ4_BMF-01          GPGCRGADYEDKATQTLGSPSISQDIMLPCGVSETPQRLFYGHA------
G1PAU1_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A1U8CPE0_BMF-02      GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A286XXB0_BMF-03      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNA------
I3MDS9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A287AIU8_BMF-05      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A287AIU8_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A287AIU8_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A287AIU8_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A287AIU8_BMF-04      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A1S3EQA2_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGSA------
A2AV74_BMF-02          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
H9GL49_BMF-01          GPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNA------
A0A2K5KGR6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K6FFR1_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
M3WRS0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K5E1W9_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYASA------
F7HPK0_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K6TW86_BMF-03      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K6RAW8_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
G3QIN5_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
Q96LC9_BMF-07          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
Q96LC9_BMF-05          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2R9BS98_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2J8QDD5_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K5MJY6_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
G7PAW6_BMF-01          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K6B5G4_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2K5Z4C3_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A096NTE9_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A2I3HD83_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA------
A0A1S3EQA2_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGSA------
Q8K589_BMF-01          GPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A2AV74_BMF-01          GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
I3MDS9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
G3T7Z4_BMF-01          GPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
F6X3N6_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNA------
G3WDQ2_BMF-01          GPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNA------
A0A1S3WU31_BMF-01      GPGLRPASQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q96LC9_BMF-06          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A286XXB0_BMF-02      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNA------
J9PB65_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A1U8CPE0_BMF-01      GPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A286XXB0_BMF-01      GPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNA------
G1SR62_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
F6TJI0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q05KI3_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGHA------
W5QFV1_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
M3WRS0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
M3YAD5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6FFR1_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
H0WYH6_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNV------
A0A096NTE9_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6L933_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A096NTE9_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K5MJY6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K5KGR6_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
G7PAW6_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
F7CM09_BMF-02          GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6B5G4_BMF-02      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6B5G4_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6B5G4_BMF-04      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K5Z4C3_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6L933_BMF-03      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6L933_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6RAW8_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A0D9R4R5_BMF-01      GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA------
F7HPK0_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K5E1W9_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6TW86_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2K6TW86_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
G3QIN5_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q96LC9_BMF-01          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q96LC9_BMF-02          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q96LC9_BMF-03          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
Q96LC9_BMF-04          GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2R9BS98_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2J8QDD5_BMF-02      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A0A2J8T301_BMF-01      GPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA------
A9XRG9_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGKSTPTSPA
K7FRX2_BMF-01          GPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNA------
U3JS06_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSA------
H0ZMX5_BMF-01          GPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSA------
A9XRG9_BMF-02          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNA------
A9XRG9_BMF-03          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNA------
G1NHG8_BMF-01          GPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGNA------
W5N4P7_BMF-01          GTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNA------
I3K2D6_BMF-01          RTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNA------
A0A096LRV0_BMF-01      RTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNA------
A0A2U9CJH3_BMF-01      RTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNA------
A9XRH0_BMF-01          DPNLQ-EEPQEGQREART--EVQIARKLQC-IADQFHRLHIQ--------
A3KND0_BMF-01          GPGCRGTDNEDKATQTLG--SPSQDIMLPCGVSETPQRLFYG--------
                                :    :            * *        :           

Q0GKC7_BMF-01          ------ELLVLAASSRAQPP------DVVLRQNVSPMERPEPRP-AQSVE
F6TGJ4_BMF-01          ----GYLLYL-PQNSPA--R--------------FGEEVDNRRQE-QSAE
G1PAU1_BMF-01          ----GYRLPL-PASFPAGSP--------------LGEQPPEGQWQHHRAE
A0A1U8CPE0_BMF-02      ----GYRLPL-PASFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A286XXB0_BMF-03      ----GYRLPL-PASFPAGLP--------------LGEQPPEGQWQ-HRAE
I3MDS9_BMF-02          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A287AIU8_BMF-05      ----GYRLPL-PAGFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A287AIU8_BMF-03      ----GYRLPL-PAGFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A287AIU8_BMF-01      ----GYRLPL-PAGFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A287AIU8_BMF-02      ----GYRLPL-PAGFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A287AIU8_BMF-04      ----GYRLPL-PAGFPAGLP--------------LGEQPPEGQWQ-HRAE
A0A1S3EQA2_BMF-02      ----GYRLPL-PAGFPA------------------AQQPPEG----HRVE
A2AV74_BMF-02          ----GYRLPL-PASFPAGSP--------------LGEQPPEGQFLQHRAE
H9GL49_BMF-01          ----GYRLHVSPIGFSLNPH--------------FQEEPQESPQ-ELRTE
A0A2K5KGR6_BMF-01      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A2K6FFR1_BMF-02      ----EPKSHV-VADPPL---------------------PTQPCF-ERRRE
M3WRS0_BMF-02          ----KPPSSV-VADSPL---------------------PTQPGF-ECRRE
A0A2K5E1W9_BMF-02      ----EPKSRV-VAGPPL---------------------SAQPGF-EWRRE
F7HPK0_BMF-02          ----EPKSHV-VAGPPL---------------------PAQPGF-EWRRE
A0A2K6TW86_BMF-03      ----EPKSCV-VAGPPL---------------------PAQPGF-EWRRK
A0A2K6RAW8_BMF-02      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
G3QIN5_BMF-02          ----EPKSCV-VADPPL---------------------PAQPCF-EWRRE
Q96LC9_BMF-07          ----EPKSCV-VADPPL---------------------PAQPCF-EWRRE
Q96LC9_BMF-05          ----EPKSCV-VADPPL---------------------PAQPCF-EWRRE
A0A2R9BS98_BMF-02      ----EPKSCV-VADPPL---------------------PAQPCF-EWRRE
A0A2J8QDD5_BMF-01      ----EPKSCV-VADPPL---------------------PAQPCF-EWRRE
A0A2K5MJY6_BMF-01      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
G7PAW6_BMF-01          ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A2K6B5G4_BMF-03      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A2K5Z4C3_BMF-02      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A096NTE9_BMF-03      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A2I3HD83_BMF-01      ----EPKSRV-VADPPL---------------------PAQPCF-EWRRE
A0A1S3EQA2_BMF-01      ----GYRLPL-PAGFPA------------------AQQPPEG----HRVE
Q8K589_BMF-01          ----GYRLPL-PASFPAGSA--------------LGEQPPEGQFLQHRAE
A2AV74_BMF-01          ----GYRLPL-PASFPAGSP--------------LGEQPPEGQFLQHRAE
I3MDS9_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
G3T7Z4_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
F6X3N6_BMF-01          ----GYRLPL-PASFPASLR--------------LGEEPPEEQW-EHRAE
G3WDQ2_BMF-01          ----GYRLPL-PANFPSSLR--------------LGAEPPEEQW-EHRAE
A0A1S3WU31_BMF-01      ----GYRLPL-PNSFPAGSP--------------FAEQRREGQW-QQRVE
Q96LC9_BMF-06          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHQAE
A0A286XXB0_BMF-02      ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
J9PB65_BMF-01          ----GYRLPL-PASFPAGLP--------------LLEQPPEGQW-QHRAE
A0A1U8CPE0_BMF-01      ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
A0A286XXB0_BMF-01      ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
G1SR62_BMF-01          ----GYRLPL-PASFPANFA--------------LGEQPPEGQW-QHRAE
F6TJI0_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
Q05KI3_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
W5QFV1_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGQW-QHRAE
M3WRS0_BMF-01          ----GYRLPL-PASFPAGLP--------------LGEQPPEGHW-QHRAE
M3YAD5_BMF-01          ----GYRLPL-PASFPAGLP--------------LGDQPPEGQW-QHRAE
A0A2K6FFR1_BMF-01      ----GYRLPL-PASFPAGLP--------------LGEQPAEGQW-QHRAE
H0WYH6_BMF-01          ----GYRLPL-PASFPAGLP--------------IGEQPPEGQW-QHRAE
A0A096NTE9_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6L933_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A096NTE9_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K5MJY6_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K5KGR6_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
G7PAW6_BMF-02          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
F7CM09_BMF-02          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6B5G4_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6B5G4_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6B5G4_BMF-04      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K5Z4C3_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6L933_BMF-03      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6L933_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2K6RAW8_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A0D9R4R5_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
F7HPK0_BMF-01          ----GYRLPL-PASFPAVLP--------------LGEQPPEGQW-QHRAE
A0A2K5E1W9_BMF-01      ----GYRLPL-PASFPAVLP--------------LGEQPPEGQW-QHRAE
A0A2K6TW86_BMF-02      ----GYRLPL-PASFPAVLP--------------LGEQPPEGQW-QHRAE
A0A2K6TW86_BMF-01      ----GYRLPL-PASFPAVLP--------------LGEQPPEGQW-QHRAE
G3QIN5_BMF-01          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
Q96LC9_BMF-01          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHQAE
Q96LC9_BMF-02          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHQAE
Q96LC9_BMF-03          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHQAE
Q96LC9_BMF-04          ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHQAE
A0A2R9BS98_BMF-01      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2J8QDD5_BMF-02      ----GYRLPL-PASFPAVLP--------------IGEQPPEGQW-QHRAE
A0A2J8T301_BMF-01      ----GYRLPL-PASFPAVLP--------------TGEQPPEGQW-QHRAE
A9XRG9_BMF-01          FQQGNYPFSTSPVRQFLSLK--------------L---------------
K7FRX2_BMF-01          ----GYRLHEPPVGFALNPH--------------LQEEPREGHQ-EARAE
U3JS06_BMF-01          ----GYRLHVPPAGFVLDPH--------------LQEEPQEGQR-EARAE
H0ZMX5_BMF-01          ----GYRLHVPPAGFVLDPH--------------LQEEPQEGQR-EARAE
A9XRG9_BMF-02          ----GYRLHVPPVGFALDPN--------------LQEEPQEGQR-EARTE
A9XRG9_BMF-03          ----GYRLHVPPVGFALDPN--------------LQEEPQEGQR-EARTE
G1NHG8_BMF-01          ----GYRLHVPPVGFALDPN--------------LQEEPQEGQR-EARTE
W5N4P7_BMF-01          ----AFRLHF-PAHFEQGGD-------EEEETGEAEEQP------VRSAE
I3K2D6_BMF-01          ----GFRLHF-PARFELVGDHRARRQEIAEQQNSMERLP-RQRPAARSVE
A0A096LRV0_BMF-01      ----GFRLHF-PAHFELVGDFDAR---QQEEQNRMEQLP-LHQPAALSLE
A0A2U9CJH3_BMF-01      ----GFRLHF-PAHFELFGDQEVRGHESEEERSGMEQLPRQQQPVAHSVE
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

Q0GKC7_BMF-01          TLIGQKLQLIGDQFYQEHIM---HHQRPQDPLWRRVATAVLTLLFGAREN
F6TGJ4_BMF-01          HRIARKLQCIGDQFHRFHLQ---RLQQNRNQFWSQILIFFRNLVMHPVGN
G1PAU1_BMF-01          IQIARKLQSIADQFHRLQMQ---QHQQNRNRMWWQFLLFLHNLALNGDEN
A0A1U8CPE0_BMF-02      VQIARKLQCIADQFHRLHIQ---QHQQNRDRAWWQVFLFLQNLALNREEN
A0A286XXB0_BMF-03      VQIARKLQCIADQFHRLHIQ---QHQQNRNRAWWQVLLFMHNLGLNGEEN
I3MDS9_BMF-02          VQIARKLQCIADQFHRLHMQ---QHQQNRNRVWWQILLFLHNLALNGDEN
A0A287AIU8_BMF-05      VQIARKLQCIADQFHRLHMQ---QEFPS----WLG---------------
A0A287AIU8_BMF-03      VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALHGDEN
A0A287AIU8_BMF-01      VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALHGDEN
A0A287AIU8_BMF-02      VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALHGDEN
A0A287AIU8_BMF-04      VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALHGDEN
A0A1S3EQA2_BMF-02      VQIARKLQCIADQFHRLHTQ---RHQQHRDRAWGQVLLFLHNLALNR-EN
A2AV74_BMF-02          VQIARKLQCIADQFHRLHTQ---QHQQNRDRAWWQVFLFLQNLALNRQEN
H9GL49_BMF-01          VQIARKLQCIADQFHRLHLQ---RHQQNRNQVWWQIFFFLHNVALNMEAN
A0A2K5KGR6_BMF-01      QERGGPQVRLGCPLHMGHQE---HRQEGHRAGLTLCLVKLFFCCYFAF--
A0A2K6FFR1_BMF-02      QERGRSQ-------------------------------------------
M3WRS0_BMF-02          QEWGRSQ-------------------------------------------
A0A2K5E1W9_BMF-02      QEWGRPE-------------------------------------------
F7HPK0_BMF-02          QEWGRPE-------------------------------------------
A0A2K6TW86_BMF-03      QEWGRSE-------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          QERGRP--------------------------------------------
Q96LC9_BMF-07          QERGRP--------------------------------------------
Q96LC9_BMF-05          QERGRP--------------------------------------------
A0A2R9BS98_BMF-02      QERGRP--------------------------------------------
A0A2J8QDD5_BMF-01      QERGRP--------------------------------------------
A0A2K5MJY6_BMF-01      QERGGP--------------------------------------------
G7PAW6_BMF-01          QERGGP--------------------------------------------
A0A2K6B5G4_BMF-03      QERGGP--------------------------------------------
A0A2K5Z4C3_BMF-02      QERGGP--------------------------------------------
A0A096NTE9_BMF-03      QERGGP--------------------------------------------
A0A2I3HD83_BMF-01      QEWGRP--------------------------------------------
A0A1S3EQA2_BMF-01      VQIARKLQCIADQFHRLHTQ---RHQQHRDRAWGQVLLFLHNLALN-REN
Q8K589_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNRDRAWRQVFLFLQNLALNRREN
A2AV74_BMF-01          VQIARKLQCIADQFHRLHTQ---QHQQNRDRAWWQVFLFLQNLALNRQEN
I3MDS9_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNRNRVWWQILLFLHNLALNGDEN
G3T7Z4_BMF-01          VQIARKLQCIADHFHRLHMQ---RHQQNRNPAWRQILQFLHHLAVNGEEN
F6X3N6_BMF-01          VQIAQKLQCIADQFHRLHMQ---RHQQNRNHVWWQILLFLHNLALNREEN
G3WDQ2_BMF-01          VQIARKLQCIADQFHRLHMQ---RHQQNQNHVWWQILLFLHNLALNREEN
A0A1S3WU31_BMF-01      VQIARKLQCIADQFHHLHMQ---QHQQNRNPVWWPFLLFLHNLALNEGEN
Q96LC9_BMF-06          ------------------------HQQNQNRVWWQILLFLHNLALNGEEN
A0A286XXB0_BMF-02      VQIARKLQCIADQFHRLHIQ---QHQQNRNRAWWQVLLFMHNLGLNGEEN
J9PB65_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALNADEN
A0A1U8CPE0_BMF-01      VQIARKLQCIADQFHRLHIQ---QHQQNRDRAWWQVFLFLQNLALNREEN
A0A286XXB0_BMF-01      VQIARKLQCIADQFHRLHIQ---QHQQNRNRAWWQVLLFMHNLGLNGEEN
G1SR62_BMF-01          VQIARKLQCIADQFHRLHLQ---QHQQNRNRVWWQILLFLHNLALNGDEN
F6TJI0_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNRNRVWWQTLLFLHNLALNGDEN
Q05KI3_BMF-01          IQIARKLQCIADQFHRLHMQ---QYQQNRNRMWWQILLFLHNVALNGDEN
W5QFV1_BMF-01          IQIARKLQCIADQFHRLHMQ---QHQQNRNRMWWQILLFLHNVALNGDEN
M3WRS0_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNRRRVWWQILLFLHNLALNAEEN
M3YAD5_BMF-01          VQIARKLQCIADQFHRLHMQ---QHQQNQNRVWWQILLFLHNLALNADEN
A0A2K6FFR1_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNQNRMWWQILLFLHNLALNGEEN
H0WYH6_BMF-01          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQVLFFLHNLALNGEEN
A0A096NTE9_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6L933_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A096NTE9_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K5MJY6_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K5KGR6_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
G7PAW6_BMF-02          VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
F7CM09_BMF-02          VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEQN
A0A2K6B5G4_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6B5G4_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6B5G4_BMF-04      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K5Z4C3_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6L933_BMF-03      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6L933_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A2K6RAW8_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A0A0D9R4R5_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRMWWQILLFLHNLALNGEEN
F7HPK0_BMF-01          VQIARKLQCIADQFHRLHVQ---QHQQNRNRMWWQVLLFLHNLALNGEEN
A0A2K5E1W9_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQVLLFLHNLALNGEEN
A0A2K6TW86_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQVLLFLHNLALNGEEN
A0A2K6TW86_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQVLLFLHNLALNGEEN
G3QIN5_BMF-01          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
Q96LC9_BMF-01          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
Q96LC9_BMF-02          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
Q96LC9_BMF-03          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
Q96LC9_BMF-04          VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
A0A2R9BS98_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
A0A2J8QDD5_BMF-02      VQIARKLQCIADQFHRLHVQ---QHQQNQNRVWWQILLFLHNLALNGEEN
A0A2J8T301_BMF-01      VQIARKLQCIADQFHRLHVQ---QHQQNRNRVWWQILLFLHNLALNGEEN
A9XRG9_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQILLFLHNLALNVEAN
U3JS06_BMF-01          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQLFLFLHNLALNTEVN
H0ZMX5_BMF-01          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQLFLFLHNLALNTEVN
A9XRG9_BMF-02          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQLFLFLHNLALNVEAN
A9XRG9_BMF-03          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQLFLFLHNLALNVEAN
G1NHG8_BMF-01          VQIARKLQCIADQFHRLHIQ---RHQQNRNQVWWQLFLFLHNLALNVEAN
W5N4P7_BMF-01          VRIGQKLQRIGDQFHRDYLHMYRRNQRNHQPMWWRLALALFTFLFERQGN
I3K2D6_BMF-01          ACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFI
A0A096LRV0_BMF-01      ACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFI
A0A2U9CJH3_BMF-01      ACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFL
A9XRH0_BMF-01          -----------------------RHQQNRNQVWWQLFLFLHNLALNVEAN
A3KND0_BMF-01          -----------------------KEALS------EIYRMFNASIPHESHR
                                                                         

Q0GKC7_BMF-01          RR------------------------------------------------
F6TGJ4_BMF-01          RAGLAQR-------------------------------------------
G1PAU1_BMF-01          RNGAGPR-------------------------------------------
A0A1U8CPE0_BMF-02      REGVGPW-------------------------------------------
A0A286XXB0_BMF-03      REGAGPR-------------------------------------------
I3MDS9_BMF-02          RDRAGPR-------------------------------------------
A0A287AIU8_BMF-05      --------------------------------------------------
A0A287AIU8_BMF-03      RNGAGPR-------------------------------------------
A0A287AIU8_BMF-01      RNGAGPR-------------------------------------------
A0A287AIU8_BMF-02      RNGAGPR-------------------------------------------
A0A287AIU8_BMF-04      RNGAGPR-------------------------------------------
A0A1S3EQA2_BMF-02      RDRAGPR-------------------------------------------
A2AV74_BMF-02          REGVGPW-------------------------------------------
H9GL49_BMF-01          RHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI--------------
A0A2K5KGR6_BMF-01      --------------------------------------------------
A0A2K6FFR1_BMF-02      --------------------------------------------------
M3WRS0_BMF-02          --------------------------------------------------
A0A2K5E1W9_BMF-02      --------------------------------------------------
F7HPK0_BMF-02          --------------------------------------------------
A0A2K6TW86_BMF-03      --------------------------------------------------
A0A2K6RAW8_BMF-02      --------------------------------------------------
G3QIN5_BMF-02          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJY6_BMF-01      --------------------------------------------------
G7PAW6_BMF-01          --------------------------------------------------
A0A2K6B5G4_BMF-03      --------------------------------------------------
A0A2K5Z4C3_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      RDRAGPR-------------------------------------------
Q8K589_BMF-01          REGVGPW-------------------------------------------
A2AV74_BMF-01          REGVGPW-------------------------------------------
I3MDS9_BMF-01          RDRAGPR-------------------------------------------
G3T7Z4_BMF-01          RNGAGPR-------------------------------------------
F6X3N6_BMF-01          RNGAGPR-------------------------------------------
G3WDQ2_BMF-01          RNGAGPR-------------------------------------------
A0A1S3WU31_BMF-01      RNREAPR-------------------------------------------
Q96LC9_BMF-06          RNGAGPR-------------------------------------------
A0A286XXB0_BMF-02      REGAGPR-------------------------------------------
J9PB65_BMF-01          RNGAGPSFQLVPGISCSGAQQDCSCL------------------------
A0A1U8CPE0_BMF-01      REGVGPW-------------------------------------------
A0A286XXB0_BMF-01      REGAGPR-------------------------------------------
G1SR62_BMF-01          RDGAGPR-------------------------------------------
F6TJI0_BMF-01          RNGAGPR-------------------------------------------
Q05KI3_BMF-01          RNGAGPR-------------------------------------------
W5QFV1_BMF-01          RNGAGPR-------------------------------------------
M3WRS0_BMF-01          RNGAGPR-------------------------------------------
M3YAD5_BMF-01          RNGAGPR-------------------------------------------
A0A2K6FFR1_BMF-01      RNGAGPR-------------------------------------------
H0WYH6_BMF-01          RNGAGPR-------------------------------------------
A0A096NTE9_BMF-01      RNGVDPRYKNARRSVRKLKASSFLSCQPE---------------------
A0A2K6L933_BMF-02      RNGAGPRPLTWNGGRCQTLLKGRLMCL-----------------------
A0A096NTE9_BMF-02      RNGVDPRPLTWNGAVVKPC-------------------------------
A0A2K5MJY6_BMF-02      RNGAGPR-------------------------------------------
A0A2K5KGR6_BMF-02      RNGAGPR-------------------------------------------
G7PAW6_BMF-02          RNGAGPR-------------------------------------------
F7CM09_BMF-02          RNGAGPR-------------------------------------------
A0A2K6B5G4_BMF-02      RNGAGPR-------------------------------------------
A0A2K6B5G4_BMF-01      RNGAGPR-------------------------------------------
A0A2K6B5G4_BMF-04      RNGAGPR-------------------------------------------
A0A2K5Z4C3_BMF-01      RNGAGPR-------------------------------------------
A0A2K6L933_BMF-03      RNGAGPR-------------------------------------------
A0A2K6L933_BMF-01      RNGAGPR-------------------------------------------
A0A2K6RAW8_BMF-01      RNGAGPR-------------------------------------------
A0A0D9R4R5_BMF-01      RNGAGPR-------------------------------------------
F7HPK0_BMF-01          RNGAGPR-------------------------------------------
A0A2K5E1W9_BMF-01      RNGAGPR-------------------------------------------
A0A2K6TW86_BMF-02      RNGAGPR-------------------------------------------
A0A2K6TW86_BMF-01      RNGAGPR-------------------------------------------
G3QIN5_BMF-01          RNGAGPR-------------------------------------------
Q96LC9_BMF-01          RNGAGPR-------------------------------------------
Q96LC9_BMF-02          RNGAGPR-------------------------------------------
Q96LC9_BMF-03          RNGAGPR-------------------------------------------
Q96LC9_BMF-04          RNGAGPR-------------------------------------------
A0A2R9BS98_BMF-01      RNGAGPR-------------------------------------------
A0A2J8QDD5_BMF-02      RNGAGPR-------------------------------------------
A0A2J8T301_BMF-01      RNGAGPR-------------------------------------------
A9XRG9_BMF-01          --------------------------------------------------
K7FRX2_BMF-01          RNHIGQR-------------------------------------------
U3JS06_BMF-01          RNHTGQR-------------------------------------------
H0ZMX5_BMF-01          RNHTGQR-------------------------------------------
A9XRG9_BMF-02          RNRTGQR-------------------------------------------
A9XRG9_BMF-03          RNRTGQR-------------------------------------------
G1NHG8_BMF-01          RNRTGQR-------------------------------------------
W5N4P7_BMF-01          RNQLRGDQR-----------------------------------------
I3K2D6_BMF-01          AGGGGGGRR-----------------------------------------
A0A096LRV0_BMF-01      AGGGGAGRR-----------------------------------------
A0A2U9CJH3_BMF-01      AGGGGAGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPP
A9XRH0_BMF-01          RNRTGQR-------------------------------------------
A3KND0_BMF-01          FHRLFQV-------------------------------------------
                                                                         

Q0GKC7_BMF-01          ------------
F6TGJ4_BMF-01          ------------
G1PAU1_BMF-01          ------------
A0A1U8CPE0_BMF-02      ------------
A0A286XXB0_BMF-03      ------------
I3MDS9_BMF-02          ------------
A0A287AIU8_BMF-05      ------------
A0A287AIU8_BMF-03      ------------
A0A287AIU8_BMF-01      ------------
A0A287AIU8_BMF-02      ------------
A0A287AIU8_BMF-04      ------------
A0A1S3EQA2_BMF-02      ------------
A2AV74_BMF-02          ------------
H9GL49_BMF-01          ------------
A0A2K5KGR6_BMF-01      ------------
A0A2K6FFR1_BMF-02      ------------
M3WRS0_BMF-02          ------------
A0A2K5E1W9_BMF-02      ------------
F7HPK0_BMF-02          ------------
A0A2K6TW86_BMF-03      ------------
A0A2K6RAW8_BMF-02      ------------
G3QIN5_BMF-02          ------------
Q96LC9_BMF-07          ------------
Q96LC9_BMF-05          ------------
A0A2R9BS98_BMF-02      ------------
A0A2J8QDD5_BMF-01      ------------
A0A2K5MJY6_BMF-01      ------------
G7PAW6_BMF-01          ------------
A0A2K6B5G4_BMF-03      ------------
A0A2K5Z4C3_BMF-02      ------------
A0A096NTE9_BMF-03      ------------
A0A2I3HD83_BMF-01      ------------
A0A1S3EQA2_BMF-01      ------------
Q8K589_BMF-01          ------------
A2AV74_BMF-01          ------------
I3MDS9_BMF-01          ------------
G3T7Z4_BMF-01          ------------
F6X3N6_BMF-01          ------------
G3WDQ2_BMF-01          ------------
A0A1S3WU31_BMF-01      ------------
Q96LC9_BMF-06          ------------
A0A286XXB0_BMF-02      ------------
J9PB65_BMF-01          ------------
A0A1U8CPE0_BMF-01      ------------
A0A286XXB0_BMF-01      ------------
G1SR62_BMF-01          ------------
F6TJI0_BMF-01          ------------
Q05KI3_BMF-01          ------------
W5QFV1_BMF-01          ------------
M3WRS0_BMF-01          ------------
M3YAD5_BMF-01          ------------
A0A2K6FFR1_BMF-01      ------------
H0WYH6_BMF-01          ------------
A0A096NTE9_BMF-01      ------------
A0A2K6L933_BMF-02      ------------
A0A096NTE9_BMF-02      ------------
A0A2K5MJY6_BMF-02      ------------
A0A2K5KGR6_BMF-02      ------------
G7PAW6_BMF-02          ------------
F7CM09_BMF-02          ------------
A0A2K6B5G4_BMF-02      ------------
A0A2K6B5G4_BMF-01      ------------
A0A2K6B5G4_BMF-04      ------------
A0A2K5Z4C3_BMF-01      ------------
A0A2K6L933_BMF-03      ------------
A0A2K6L933_BMF-01      ------------
A0A2K6RAW8_BMF-01      ------------
A0A0D9R4R5_BMF-01      ------------
F7HPK0_BMF-01          ------------
A0A2K5E1W9_BMF-01      ------------
A0A2K6TW86_BMF-02      ------------
A0A2K6TW86_BMF-01      ------------
G3QIN5_BMF-01          ------------
Q96LC9_BMF-01          ------------
Q96LC9_BMF-02          ------------
Q96LC9_BMF-03          ------------
Q96LC9_BMF-04          ------------
A0A2R9BS98_BMF-01      ------------
A0A2J8QDD5_BMF-02      ------------
A0A2J8T301_BMF-01      ------------
A9XRG9_BMF-01          ------------
K7FRX2_BMF-01          ------------
U3JS06_BMF-01          ------------
H0ZMX5_BMF-01          ------------
A9XRG9_BMF-02          ------------
A9XRG9_BMF-03          ------------
G1NHG8_BMF-01          ------------
W5N4P7_BMF-01          ------------
I3K2D6_BMF-01          ------------
A0A096LRV0_BMF-01      ------------
A0A2U9CJH3_BMF-01      PANGRLPCALIG
A9XRH0_BMF-01          ------------
A3KND0_BMF-01          ------------
                                   

© 1998-2019