Dataset for protein Bmf of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

151 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452H3N6_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A1S3EQA2_BMF-02      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A0A337ST43_BMF-04      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A0A337ST43_BMF-05      MTRTSPGQKKRPRWEWLWEGPGRRCGASLSSEAGHIWGGCHPQWYFITRS
A2AV74_BMF-01          --------MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPL
A0A286XXB0_BMF-02      ------------------------------------------MPGAGVFW
G3WDQ2_BMF-01          --------------------------------------------------
G3T7Z4_BMF-01          ----------MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPA
A0A287CXH0_BMF-01      --------------------MPRAGVFWKQYRAVRSGLLRRPPESAAAAG
A0A1S3WU31_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
F7CM09_BMF-01          --------------------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K5VLE9_BMF-02      --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
F7CM09_BMF-03          --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      --------------------------------------------------
A0A337ST43_BMF-03      --------------------------------------------------
A0A3Q2HR24_BMF-02      --------------------------------------------------
A0A3Q2HR24_BMF-01      --------------------------------------------------
J9PB65_BMF-03          --------------------------------------------------
J9PB65_BMF-04          --------------------------------------------------
J9PB65_BMF-02          --------------------------------------------------
J9PB65_BMF-01          --------------------------------------------------
A0A493T7X1_BMF-01      --------------------------------------------------
H9GL49_BMF-01          --------------------------------------------------
A0A3Q2UCA0_BMF-01      --------------------------------------------------
A0A3Q2UCA0_BMF-02      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A3Q2UCA0_BMF-03      --------------------------------------------------
A0A3Q2UCA0_BMF-04      --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      --------------------------------------------------
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A452H3N6_BMF-01      --------------------------------------------MDPPNY
A0A287AIU8_BMF-02      --------------------------------------------MEPPQC
G1PAU1_BMF-01          --------------------------------------------MEPPQC
A0A287AIU8_BMF-01      --------------------------------------------MEPPQC
A0A1U8CPE0_BMF-02      ---------------------------------------IFPGEMEPPQC
A0A286XXB0_BMF-03      ---------------------------------------VFPREMEPPQC
A0A287CXH0_BMF-02      ---------------------------------------VFPEEMEPPQC
A0A1S3EQA2_BMF-02      ---------------------------------------IVPGEMEPPQC
A2AV74_BMF-02          ---------------------------------------MSPGEMEPPQC
A0A337ST43_BMF-02      --------------------------------------------MEPPQC
A0A2K5KGP2_BMF-01      --------------------------------------------MEPSRC
A0A2K6FFN3_BMF-02      --------------------------------------------MEPSHC
A0A2K5E1Q4_BMF-02      --------------------------------------------MEPSQC
A0A2K5RN49_BMF-02      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-03      --------------------------------------------MEPSQC
A0A2K6RAW1_BMF-02      --------------------------------------------MEPSRC
A0A2I2Z168_BMF-02      --------------------------------------------MEPSQC
A0A2R9BS98_BMF-02      --------------------------------------------MEPSQC
A0A2J8QDD5_BMF-01      --------------------------------------------MEPSQC
A0A2K5MJW4_BMF-01      --------------------------------------------MEPSRC
A0A2K5VLE9_BMF-01      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-03      --------------------------------------------MEPSRC
A0A2K5Z4A9_BMF-02      --------------------------------------------MEPSRC
A0A096NTE9_BMF-03      --------------------------------------------MEPSRC
A0A2I3HD83_BMF-01      --------------------------------------------MEPSQC
A0A1S3EQA2_BMF-01      --------------------------------------------MEPPQC
Q8K589_BMF-01          --------------------------------------------MEPPQC
A0A337ST43_BMF-04      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A0A337ST43_BMF-05      FVISVGPHFPQVEGKGERKGGVLQVRPSGRGQHPRCLHCTPAGEMEPPQC
A2AV74_BMF-01          EFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQC
A0A286XXB0_BMF-02      KQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQC
G3WDQ2_BMF-01          --------------------------------------------MESPHY
G3T7Z4_BMF-01          ELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWSHPGEMEPSQC
A0A287CXH0_BMF-01      PASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
A0A1S3WU31_BMF-01      --------------------------------------------MELPQC
A0A1U8CPE0_BMF-01      --------------------------------------------MEPPQC
G1SR62_BMF-01          --------------------------------------------MEPPQC
M3YAD5_BMF-01          --------------------------------------------MEPPQC
U6CSY8_BMF-01          --------------------------------------------MEPPQC
A0A452SED0_BMF-01      --------------------------------------------MEPPQC
A0A384D070_BMF-01      --------------------------------------------MEPPQC
W5QFV1_BMF-01          ----------------------------------------LTGEMEPPQC
L8IXF5_BMF-01          --------------------------------------------MEPPQC
A0A452F2E0_BMF-01      --------------------------------------------MEPPQC
A0A452F2E0_BMF-02      --------------------------------------------MEPPQC
Q05KI3_BMF-01          --------------------------------------------MEPPQC
Q05KI3_BMF-02          --------------------------------------------MEPPQC
A0A2K6FFN3_BMF-01      --------------------------------------------MEPSHC
H0WYH6_BMF-01          --------------------------------------------MEPSQC
A0A096NTE9_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-02      --------------------------------------------MEPSRC
A0A2K5E1Q4_BMF-01      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-02      --------------------------------------------MEPSQC
A0A2K6TW78_BMF-01      --------------------------------------------MEPSQC
A0A2K5RN49_BMF-01      --------------------------------------------MEPSQC
A0A2I2Z168_BMF-01      --------------------------------------------MEPSQC
A0A2R9BS98_BMF-01      --------------------------------------------MEPSQC
A0A2J8QDD5_BMF-02      --------------------------------------------MEPSQC
A0A2J8T301_BMF-01      --------------------------------------------MEPSQC
F7CM09_BMF-01          --------------------------------------------MEPSRC
A0A2K5MJW4_BMF-02      --------------------------------------------MEPSRC
A0A2K5KGP2_BMF-02      --------------------------------------------MEPSRC
A0A2K5VLE9_BMF-02      --------------------------------------------MEPSRC
F7CM09_BMF-02          --------------------------------------------MEPSRC
F7CM09_BMF-03          --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-01      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-02      --------------------------------------------MEPSRC
A0A2K6B5F6_BMF-04      --------------------------------------------MEPSRC
A0A2K5Z4A9_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-01      --------------------------------------------MEPSRC
A0A2K6L919_BMF-03      --------------------------------------------MEPSRC
A0A2K6RAW1_BMF-01      --------------------------------------------MEPSRC
A0A0D9R4R5_BMF-01      --------------------------------------------MEPSRC
A0A337ST43_BMF-01      --------------------------------------------MEPPQC
A0A337ST43_BMF-03      --------------------------------------------MEPPQC
A0A3Q2HR24_BMF-02      --------------------------------------------MEPPQC
A0A3Q2HR24_BMF-01      --------------------------------------------MEPPQC
J9PB65_BMF-03          --------------------------------------------MEPPQC
J9PB65_BMF-04          ----------MGAREGLGCGRVGGPWRTGAPGCGNAVQDPYLGEMEPPQC
J9PB65_BMF-02          --------------------------------------------MEPPQC
J9PB65_BMF-01          --------------------------------------------MEPPQC
A0A493T7X1_BMF-01      --------------------------------------------MDRPSY
H9GL49_BMF-01          --------------------------------------------MDPPGY
A0A3Q2UCA0_BMF-01      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-02      --------------------------------------------MDRPSY
K7FRX2_BMF-01          --------------------------------------------MDPPSY
U3JS06_BMF-01          --------------------------------------------MDRPSY
H0ZMX5_BMF-01          --------------------------------------------MDRPSY
A0A493T7X1_BMF-02      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-03      --------------------------------------------MDRPSY
A0A3Q2UCA0_BMF-04      --------------------------------------------MDRPSY
G1NHG8_BMF-01          --------------------------------------------MDRPSY
A0A3B4UNJ0_BMF-01      --------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      ---------------------------------MCLSGISGHSSYSAPPR
Q0GKC7_BMF-01          --------------------------------------------------
A0A3B3RH63_BMF-01      --------------------------------------------------
W5N4P7_BMF-01          --------------------------------------------------
A0A3B1K1X5_BMF-01      --------------------------------------------------
A0A3B4CNJ8_BMF-01      --------------------------------------------------
A0A2U9CJH3_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-01      --------------------------------------------------
A0A3Q3QZ16_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      --------------------------------------------------
A0A3Q2PJX9_BMF-03      --------------------------------------------------
A0A3B5QK08_BMF-01      --------------------------------------------------
A0A3B5QK08_BMF-02      --------------------------------------------------
A0A096LRV0_BMF-01      --------------------------------------------------
A0A3B3WU80_BMF-01      --------------------------------------------------
A0A3P9Q8E2_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q3GUU5_BMF-01      --------------------------------------------------
A0A3B5B8F6_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-02      --------------------------------------------------
A0A3P8UA78_BMF-01      --------------------------------------------------
A0A3P8UA78_BMF-03      --------------------------------------------------
A0A3B3CGR9_BMF-01      --------------------------------------------------
A0A3P9K487_BMF-02      --------------------------------------------------
A0A3P9K487_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-01      --------------------------------------------------
A0A3B3HAU1_BMF-03      --------------------------------------------------
A0A3B3HAU1_BMF-02      --------------------------------------------------
A0A3B3HAU1_BMF-04      --------------------------------------------------
A0A3P9ICE1_BMF-04      --------------------------------------------------
A0A3Q2ZA20_BMF-01      --------------------------------------------------
A0A3P8NFE2_BMF-02      --------------------------------------------------
I3K2D6_BMF-01          --------------------------------------------------
A0A3P8NFE2_BMF-01      --------------------------------------------------
A0A3Q3C5V2_BMF-01      --------------------------------------------------
A0A3P9DPJ5_BMF-02      --------------------------------------------------
A0A3P9DPJ5_BMF-01      --------------------------------------------------
A0A3B4ETH0_BMF-01      --------------------------------------------------
A0A3Q4G1I4_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-01      --------------------------------------------------
A0A3Q1FVH7_BMF-02      --------------------------------------------------
A0A3Q1D1K3_BMF-01      --------------------------------------------------
A0A3P8RKY9_BMF-01      --------------------------------------------------
A0A3Q1IPR4_BMF-01      --------------------------------------------------
A0A3B4U5H8_BMF-01      --------------------------------------------------
A0A3B4WM88_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      --------------------------------------------------
A0A3Q3VLX6_BMF-01      --------------------------------------------------
A0A3B5KWG6_BMF-01      --------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------MDRPSY
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A452H3N6_BMF-01      LEDDYSSLDGLDDDVFHSDFGLTG-QPGEMTPPGIFTQNQSYSCLLGRFQ
A0A287AIU8_BMF-02      VEE-------LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQ
G1PAU1_BMF-01          VEE-------LEDDVFQPED-ELGTQPGSLPSADLFAQSQ-LDCPLSRLQ
A0A287AIU8_BMF-01      VEE-------LEDDVFQPEEGEPGTQPRR-VSADPFVQSQ-LDCPLSRLQ
A0A1U8CPE0_BMF-02      VEE-------LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQ
A0A286XXB0_BMF-03      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLH
A0A287CXH0_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A1S3EQA2_BMF-02      VEE-------LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQ
A2AV74_BMF-02          VEE-------LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
A0A337ST43_BMF-02      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A2K5KGP2_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6FFN3_BMF-02      VEE-------LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQ
A0A2K5E1Q4_BMF-02      VEE-------LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5RN49_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-03      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6RAW1_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2I2Z168_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2R9BS98_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8QDD5_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5MJW4_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5VLE9_BMF-01      VEE-------LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5Z4A9_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A096NTE9_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2I3HD83_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A1S3EQA2_BMF-01      VEE-------LEDDVFQAEDGEPGTQPGSLLSATLFAQSQ-LDCPLSRLQ
Q8K589_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A337ST43_BMF-04      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A337ST43_BMF-05      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A2AV74_BMF-01          VEE-------LEDDVFQSEDGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
A0A286XXB0_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLGRLH
G3WDQ2_BMF-01          VEE-------LEDDVFHPEDSEPGAQPGGLTSPALFAQSQ-PDYMLDGLQ
G3T7Z4_BMF-01          VEE-------LEDDVFQPEEGEPGTQPGGLLSADLFAQSQ-LDCPLSRLQ
A0A287CXH0_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLQ
A0A1S3WU31_BMF-01      VDE-------LEDDVFQPEDGEPGTTPGSLLSSDLFAQSP-MDCSLSRLQ
A0A1U8CPE0_BMF-01      VEE-------LEDDVFQSEDGEPGTQPGSLLSADPFAQSQ-LDCPLSRLQ
G1SR62_BMF-01          VEE-------LEDDVFQPEDGEPGTQPQSLLSADPFAQSQ-LDCPLGRLH
M3YAD5_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
U6CSY8_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A452SED0_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A384D070_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
W5QFV1_BMF-01          VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
L8IXF5_BMF-01          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
A0A452F2E0_BMF-01      VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
A0A452F2E0_BMF-02      VEE-------LEDDVFQPEDGEPGAQPRRLLSADLFAQSQ-LDCPLSRLQ
Q05KI3_BMF-01          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
Q05KI3_BMF-02          VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAQSQ-LDCPLSRLQ
A0A2K6FFN3_BMF-01      VEE-------LEDDVFQPEDGESGTQPGSVLSADLFAQSQ-LDCPLSRLQ
H0WYH6_BMF-01          VEE-------LEDDVFQPEDGELGT--GNVLSADLFAQSQ-LDCPLSRLQ
A0A096NTE9_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5E1Q4_BMF-01      VEE-------LEDDVFQSEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-02      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K6TW78_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2K5RN49_BMF-01      VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2I2Z168_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2R9BS98_BMF-01      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8QDD5_BMF-02      VEE-------LEDDVFQPEDGEPVTQPGSLLSADLFAQSL-LDCPLSRLQ
A0A2J8T301_BMF-01      VEE-------LEDDVFQPEDGEPGTQSGSLLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-01          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5MJW4_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5KGP2_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5VLE9_BMF-02      VEE-------LEDDVFQPEDGEPGSQPGSSLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-02          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
F7CM09_BMF-03          VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-02      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6B5F6_BMF-04      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K5Z4A9_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6L919_BMF-03      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A2K6RAW1_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A0D9R4R5_BMF-01      VEE-------LEDDVFQPEDGEPGAQPGSSLSADLFAQSL-LDCPLSRLQ
A0A337ST43_BMF-01      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A337ST43_BMF-03      VEE-------LEDDVFQPEDVEPGTQPGSLLSANLFAQSQ-LDCPLSHLQ
A0A3Q2HR24_BMF-02      VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLR
A0A3Q2HR24_BMF-01      VEE-------LEDDVFQPEDGEPGTQPRSLLSADLFAPSQ-LDCPLSHLR
J9PB65_BMF-03          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-04          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-02          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
J9PB65_BMF-01          VEE-------LEDDVFQPEDGEPGTQPGSLLSADLFAQSQ-LDCPLSRLH
A0A493T7X1_BMF-01      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
H9GL49_BMF-01          LDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQ
A0A3Q2UCA0_BMF-01      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-02      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
K7FRX2_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQ
U3JS06_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQ
H0ZMX5_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQ
A0A493T7X1_BMF-02      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-03      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3Q2UCA0_BMF-04      LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
G1NHG8_BMF-01          LEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQ
A0A3B4UNJ0_BMF-01      MDD-------EEEDMSQPI-------------------------------
A0A3B4B6Y3_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3P9ICE1_BMF-01      MDD-------EEDDVFEPD-------------------------------
Q0GKC7_BMF-01          MDE-------DEDDVFRKG-------------------------------
A0A3B3RH63_BMF-01      MDD-------DDDDVFHTD-------------------------------
W5N4P7_BMF-01          MEE-------DEDDVFHPSH------------------------------
A0A3B1K1X5_BMF-01      MDD-------EEDDVFVTD-------------------------------
A0A3B4CNJ8_BMF-01      MDE-------DEDDVFVMD-------------------------------
A0A2U9CJH3_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q2YCX7_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2YCX7_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A3P8ZIE7_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q3QZ16_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3QZ16_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2PJX9_BMF-03      MED-------EEDDVFEPD-------------------------------
A0A3B5QK08_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3B5QK08_BMF-02      MED-------EEDDVFEPD-------------------------------
A0A096LRV0_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3B3WU80_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3P9Q8E2_BMF-01      MED-------EEDDVFEPD-------------------------------
A0A3Q2CXC4_BMF-01      MEE-------EEDDVFEPD-------------------------------
A0A3Q2CXC4_BMF-02      MEE-------EEDDVFEPD-------------------------------
A0A3Q3GUU5_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B5B8F6_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8UA78_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3P8UA78_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8UA78_BMF-03      MDD-------EEDDVFEPD-------------------------------
A0A3B3CGR9_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P9K487_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3P9K487_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-03      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3B3HAU1_BMF-04      MDD-------EEDDVFEPD-------------------------------
A0A3P9ICE1_BMF-04      MDD-------EEDDVFEPD-------------------------------
A0A3Q2ZA20_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8NFE2_BMF-02      MDD-------EEDDVFEPK-------------------------------
I3K2D6_BMF-01          MDD-------EEDDVFEPK-------------------------------
A0A3P8NFE2_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q3C5V2_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3P9DPJ5_BMF-02      MDD-------EEDDVFEPK-------------------------------
A0A3P9DPJ5_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3B4ETH0_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q4G1I4_BMF-01      MDD-------EEDDVFEPK-------------------------------
A0A3Q1FVH7_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q1FVH7_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q1D1K3_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3P8RKY9_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q1IPR4_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B4U5H8_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3B4WM88_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3RVI2_BMF-01      MDD-------EEDDVFEPD-------------------------------
A0A3Q3RVI2_BMF-02      MDD-------EEDDVFEPD-------------------------------
A0A3Q3VLX6_BMF-01      MDD-------DEDDVFEPE-------------------------------
A0A3B5KWG6_BMF-01      MDD-------EEDDVFQPD-------------------------------
A9XRH0_BMF-01          LEEDYSSLDGLDDDVFHSD--DFGLAGNA-----------GY-----RLH
A3KND0_BMF-01          -------MDELDDDVFYPD--AFGYPDQTITSSSLFNQSQSYTCLLGRFH
                                  ::*:                                   

A0A452H3N6_BMF-01      LFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYG
A0A287AIU8_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
G1PAU1_BMF-01          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A287AIU8_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1U8CPE0_BMF-02      LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A286XXB0_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
A0A287CXH0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1S3EQA2_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A2AV74_BMF-02          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5KGP2_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6FFN3_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5E1Q4_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5RN49_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6TW78_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6RAW1_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2I2Z168_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2R9BS98_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2J8QDD5_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5MJW4_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5VLE9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K6B5F6_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2K5Z4A9_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A096NTE9_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYA
A0A2I3HD83_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYA
A0A1S3EQA2_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q8K589_BMF-01          LFPLTHCCGPGLRPVSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-04      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-05      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A2AV74_BMF-01          LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A286XXB0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
G3WDQ2_BMF-01          LFPLTHCCGPGLRSVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYG
G3T7Z4_BMF-01          LFPLTHCCGPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A287CXH0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1S3WU31_BMF-01      LFPLTHCCGPGLRPASQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A1U8CPE0_BMF-01      LFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
G1SR62_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
M3YAD5_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
U6CSY8_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452SED0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A384D070_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
W5QFV1_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
L8IXF5_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452F2E0_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A452F2E0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q05KI3_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
Q05KI3_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6FFN3_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
H0WYH6_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A096NTE9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5E1Q4_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6TW78_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6TW78_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5RN49_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2I2Z168_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2R9BS98_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2J8QDD5_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A2J8T301_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5MJW4_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5KGP2_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5VLE9_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
F7CM09_BMF-03          LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6B5F6_BMF-04      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K5Z4A9_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6L919_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A2K6RAW1_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A0D9R4R5_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A337ST43_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A3Q2HR24_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A3Q2HR24_BMF-01      LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-03          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-04          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-02          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
J9PB65_BMF-01          LFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYG
A0A493T7X1_BMF-01      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYA
H9GL49_BMF-01          LFPLTHCCGPGSRQARQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYG
A0A3Q2UCA0_BMF-01      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-02      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
K7FRX2_BMF-01          LFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYG
U3JS06_BMF-01          LFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
H0ZMX5_BMF-01          LFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A493T7X1_BMF-02      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-03      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3Q2UCA0_BMF-04      LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
G1NHG8_BMF-01          LFPLTHCCGPGVRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEPRRLFYG
A0A3B4UNJ0_BMF-01      ----SHLWGTSFRDVKYEDRATPIAA-------GQALTAVTAAPLILFVW
A0A3B4B6Y3_BMF-01      ----LHCWHTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFY-
A0A3P9ICE1_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
Q0GKC7_BMF-01          ----LQHWPPPHLQIK----QTELAGRPAGSRNGMLLCRHLQQHGHFLYG
A0A3B3RH63_BMF-01      ----PLTYQPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYG
W5N4P7_BMF-01          ---FSHCWGTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYG
A0A3B1K1X5_BMF-01      ----PEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYG
A0A3B4CNJ8_BMF-01      ----TQYWRSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYG
A0A2U9CJH3_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q2YCX7_BMF-01      ----PHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYG
A0A3Q2YCX7_BMF-02      ----PHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYG
A0A3P8ZIE7_BMF-01      ----SYCWHTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYG
A0A3Q3QZ16_BMF-01      ----PHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYG
A0A3Q3QZ16_BMF-02      ----PHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYG
A0A3Q2PJX9_BMF-02      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3Q2PJX9_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3Q2PJX9_BMF-03      ----PNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYG
A0A3B5QK08_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYG
A0A3B5QK08_BMF-02      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYG
A0A096LRV0_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3B3WU80_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3P9Q8E2_BMF-01      ----PNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYG
A0A3Q2CXC4_BMF-01      ----PNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYR
A0A3Q2CXC4_BMF-02      ----PNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYR
A0A3Q3GUU5_BMF-01      ----PHSWRTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYG
A0A3B5B8F6_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3P8UA78_BMF-02      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3P8UA78_BMF-01      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3P8UA78_BMF-03      ----PHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYG
A0A3B3CGR9_BMF-01      ----PNNWRTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3P9K487_BMF-02      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYG
A0A3P9K487_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLSEEPRPLFYG
A0A3B3HAU1_BMF-01      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-03      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-02      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3B3HAU1_BMF-04      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3P9ICE1_BMF-04      ----PNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYG
A0A3Q2ZA20_BMF-01      ----PSCWRTTFREIKCEDRGTQTPGPALVPHSGMLPCGVAEEPRPLFYG
A0A3P8NFE2_BMF-02      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
I3K2D6_BMF-01          ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P8NFE2_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q3C5V2_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P9DPJ5_BMF-02      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3P9DPJ5_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3B4ETH0_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q4G1I4_BMF-01      ----ANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYG
A0A3Q1FVH7_BMF-01      ----THCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q1FVH7_BMF-02      ----THCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q1D1K3_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3P8RKY9_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYG
A0A3Q1IPR4_BMF-01      ----PHCWRTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYG
A0A3B4U5H8_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYG
A0A3B4WM88_BMF-01      ----PHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYG
A0A3Q3RVI2_BMF-01      ----PHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q3RVI2_BMF-02      ----PHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYG
A0A3Q3VLX6_BMF-01      ----AHCWRTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYV
A0A3B5KWG6_BMF-01      ----PYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYG
A9XRH0_BMF-01          VPPVGFALDPNLQ-EEPQEGQREART--EVQIARKLQC-IADQFHRLHIQ
A3KND0_BMF-01          LFPFSHCCGPGCRGTDNEDKATQTLG--SPSQDIMLPCGVSETPQRLFYG
                                .                                    :   

A0A452H3N6_BMF-01      NAGYRLHVPPVGFALNPHLQEEPRE-------------------------
A0A287AIU8_BMF-02      ----------------LPLGEQPPE-------------------------
G1PAU1_BMF-01          NAGYRLPL-PASFPAGSPLGEQPPE-------------------------
A0A287AIU8_BMF-01      NAGYRLPL-PAGFPAGLPLGEQPPE-------------------------
A0A1U8CPE0_BMF-02      NAGYRLPL-PASFPAGLPLGEQPPE-------------------------
A0A286XXB0_BMF-03      NAGYRLPL-PASFPAGLPLGEQPPE-------------------------
A0A287CXH0_BMF-02      NAGYRLPL-PASFPAGLPLGEQPPE-------------------------
A0A1S3EQA2_BMF-02      SAGYRLPL-PAGFPA----AQQPPE-------------------------
A2AV74_BMF-02          NAGYRLPL-PASFPAGSPLGEQPPE-------------------------
A0A337ST43_BMF-02      PAKPPSSVV-ADSPL-------PTQ-------------------------
A0A2K5KGP2_BMF-01      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2K6FFN3_BMF-02      PAEPKSHVV-ADPPL-------PTQ-------------------------
A0A2K5E1Q4_BMF-02      SAEPKSRVV-AGPPL-------SAQ-------------------------
A0A2K5RN49_BMF-02      PAEPKSRVV-AGPPL-------PAQ-------------------------
A0A2K6TW78_BMF-03      PAEPKSCVV-AGPPL-------PAQ-------------------------
A0A2K6RAW1_BMF-02      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2I2Z168_BMF-02      PAEPKSCVV-ADPPL-------PAQ-------------------------
A0A2R9BS98_BMF-02      PAEPKSCVV-ADPPL-------PAQ-------------------------
A0A2J8QDD5_BMF-01      PAEPKSCVV-ADPPL-------PAQ-------------------------
A0A2K5MJW4_BMF-01      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2K5VLE9_BMF-01      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2K6B5F6_BMF-03      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2K5Z4A9_BMF-02      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A096NTE9_BMF-03      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A2I3HD83_BMF-01      PAEPKSRVV-ADPPL-------PAQ-------------------------
A0A1S3EQA2_BMF-01      SAGYRLPLP-AGFPA----AQQPPE-------------------------
Q8K589_BMF-01          NAGYRLPLP-ASFPAGSALGEQPPE-------------------------
A0A337ST43_BMF-04      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A337ST43_BMF-05      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A2AV74_BMF-01          NAGYRLPLP-ASFPAGSPLGEQPPE-------------------------
A0A286XXB0_BMF-02      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
G3WDQ2_BMF-01          NAGYRLPLP-ANFPSSLRLGAEPPE-------------------------
G3T7Z4_BMF-01          NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A287CXH0_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A1S3WU31_BMF-01      NAGYRLPLP-NSFPAGSPFAEQRRE-------------------------
A0A1U8CPE0_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
G1SR62_BMF-01          NAGYRLPLP-ASFPANFALGEQPPE-------------------------
M3YAD5_BMF-01          NAGYRLPLP-ASFPAGLPLGDQPPE-------------------------
U6CSY8_BMF-01          NAGYRLPLP-ASFPAGLPLGDQPPE-------------------------
A0A452SED0_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A384D070_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
W5QFV1_BMF-01          NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
L8IXF5_BMF-01          NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A452F2E0_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A452F2E0_BMF-02      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
Q05KI3_BMF-01          HAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
Q05KI3_BMF-02          HAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A2K6FFN3_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPAE-------------------------
H0WYH6_BMF-01          NVGYRLPLP-ASFPAGLPIGEQPPE-------------------------
A0A096NTE9_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6L919_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K5E1Q4_BMF-01      NAGYRLPLP-ASFPAVLPLGEQPPE-------------------------
A0A2K6TW78_BMF-02      NAGYRLPLP-ASFPAVLPLGEQPPE-------------------------
A0A2K6TW78_BMF-01      NAGYRLPLP-ASFPAVLPLGEQPPE-------------------------
A0A2K5RN49_BMF-01      NAGYRLPLP-ASFPAVLPLGEQPPE-------------------------
A0A2I2Z168_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2R9BS98_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2J8QDD5_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2J8T301_BMF-01      NAGYRLPLP-ASFPAVLPTGEQPPE-------------------------
F7CM09_BMF-01          NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K5MJW4_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K5KGP2_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K5VLE9_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
F7CM09_BMF-02          NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
F7CM09_BMF-03          NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6B5F6_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6B5F6_BMF-02      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6B5F6_BMF-04      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K5Z4A9_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6L919_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6L919_BMF-03      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A2K6RAW1_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A0D9R4R5_BMF-01      NAGYRLPLP-ASFPAVLPIGEQPPE-------------------------
A0A337ST43_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A337ST43_BMF-03      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A3Q2HR24_BMF-02      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
A0A3Q2HR24_BMF-01      NAGYRLPLP-ASFPAGLPLGEQPPE-------------------------
J9PB65_BMF-03          NAGYRLPLP-ASFPAGLPLLEQPPE-------------------------
J9PB65_BMF-04          NAGYRLPLP-ASFPAGLPLLEQPPE-------------------------
J9PB65_BMF-02          NAGYRLPLP-ASFPAGLPLLEQPPE-------------------------
J9PB65_BMF-01          NAGYRLPLP-ASFPAGLPLLEQPPE-------------------------
A0A493T7X1_BMF-01      SAEQKSSVV-AAFSLSTQLGLKRGG-------------------------
H9GL49_BMF-01          NAGYRLHVSPIGFSLNPHFQEEPQE-------------------------
A0A3Q2UCA0_BMF-01      NAGYRLHVPPVGFALDPNLQEEPQE-------------------------
A0A3Q2UCA0_BMF-02      NAGYRLHVPPVGFALDPNLQEEPQE-------------------------
K7FRX2_BMF-01          NAGYRLHEPPVGFALNPHLQEEPRE-------------------------
U3JS06_BMF-01          SAGYRLHVPPAGFVLDPHLQEEPQE-------------------------
H0ZMX5_BMF-01          SAGYRLHVPPAGFVLDPHLQEEPQE-------------------------
A0A493T7X1_BMF-02      NAGYRLHVPPVGFALDPHLQEEPQE-------------------------
A0A3Q2UCA0_BMF-03      NAGYRLHVPPVGFALDPNLQEEPQE-------------------------
A0A3Q2UCA0_BMF-04      NAGYRLHVPPVGFALDPNLQEEPQE-------------------------
G1NHG8_BMF-01          NAGYRLHVPPVGFALDPNLQEEPQE-------------------------
A0A3B4UNJ0_BMF-01      WVPHWELSPSTKMNMLRFSENRPEE-----------------------Q-
A0A3B4B6Y3_BMF-01      ----------AHFELGEDQEASESLQEGEMQNGREPLP----------RH
A0A3P9ICE1_BMF-01      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
Q0GKC7_BMF-01          NAELLVLAA----------SSRAQPPDVVLRQNVSPME----------RP
A0A3B3RH63_BMF-01      SAGLRLHFP-ALSVPGGHPPQEERQ-----------------------PD
W5N4P7_BMF-01          NAAFRLHFP-AHFEQGGDEEEETGE-----------------------AE
A0A3B1K1X5_BMF-01      SAGLLLLAPSARSERVGDAMFREEH--------RAVEP----------RR
A0A3B4CNJ8_BMF-01      SAGLLLLAPSVRPEHVEGAMLQEDQ--------LAMEP----------RR
A0A2U9CJH3_BMF-01      NAGFRLHFP-AHFELFGDQEVRGHE-SEEERSGMEQLPR---------QQ
A0A3Q2YCX7_BMF-01      NAGFRLHFP-AHFELVGEQEERLQESDDGMEQQLQQQQ----------QQ
A0A3Q2YCX7_BMF-02      NAGFRLHFP-AHFELVGEQEERLQESDDGMEQQLQQQQ----------QQ
A0A3P8ZIE7_BMF-01      NAGFRLHFP-AQFECVGDPGPQQRP--QAVRGGMEH------------PQ
A0A3Q3QZ16_BMF-01      NAGFRLHFP-AHFELVGDQEARRQE----DQNGMEHLP----------RQ
A0A3Q3QZ16_BMF-02      NAGFRLHFP-AHFELVGDQEARRQE----DQNGMEHLP----------RQ
A0A3Q2PJX9_BMF-02      NAGFRLHFP-AHFELVGDFDARRQE----EQNRMEPLP----------LH
A0A3Q2PJX9_BMF-01      NAGFRLHFP-AHFELVGDFDARRQE----EQNRMEPLP----------LH
A0A3Q2PJX9_BMF-03      NAGFRLHFP-AHFELVGDFDARRQE----EQNRMEPLP----------LH
A0A3B5QK08_BMF-01      NAGFRLHFP-AHFELVGDFDARQQE----EQNRMEQLP----------LH
A0A3B5QK08_BMF-02      NAGFRLHFP-AHFELVGDFDARQQE----EQNRMEQLP----------LH
A0A096LRV0_BMF-01      NAGFRLHFP-AHFELVGDFDARQQE----EQNRMEQLP----------LH
A0A3B3WU80_BMF-01      NAGFRLHFP-AHFELVGDFDARQQE----EQNRMEQLP----------LH
A0A3P9Q8E2_BMF-01      NAGFRLHFP-AHFELVRDFDARQQE----EQNRMEQLP----------LH
A0A3Q2CXC4_BMF-01      NAGFRLHFP-AHFELVGDFDVRRQA----EHNRMEQLP----------LQ
A0A3Q2CXC4_BMF-02      NAGFRLHFP-AHFELVGDFDVRRQA----EHNRMEQLP----------LQ
A0A3Q3GUU5_BMF-01      NAGFRLHFP-ANFELVGDQEESGQE-SELQQIGMEQ-------------Q
A0A3B5B8F6_BMF-01      NAGFRLHFP-ARFELIGDHQARQQQGSEMEQNGMEQLP----------RQ
A0A3P8UA78_BMF-02      NAGFRLHFP-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQ
A0A3P8UA78_BMF-01      NAGFRLHFP-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQ
A0A3P8UA78_BMF-03      NAGFRLHFP-AHFELIGDRETRRRQ-SDEERNRMEPRPQQQQQQQRQQQQ
A0A3B3CGR9_BMF-01      NAGFRLHFP-ARFELAGDLEARRHD-REAERGGMERLP----------RQ
A0A3P9K487_BMF-02      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3P9K487_BMF-01      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3B3HAU1_BMF-01      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3B3HAU1_BMF-03      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3B3HAU1_BMF-02      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3B3HAU1_BMF-04      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3P9ICE1_BMF-04      NAGFRLHFP-ARFELAGDLEVRRHD-REAERRGMERLP----------RQ
A0A3Q2ZA20_BMF-01      NAGFRLHFP-ARFELIRDLEARQQD-REEEPNRMERLP----------RQ
A0A3P8NFE2_BMF-02      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
I3K2D6_BMF-01          NAGFRLHFP-ARFELVGDHRARRQE-IAEQQNSMERLP----------RQ
A0A3P8NFE2_BMF-01      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3Q3C5V2_BMF-01      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3P9DPJ5_BMF-02      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3P9DPJ5_BMF-01      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3B4ETH0_BMF-01      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3Q4G1I4_BMF-01      NAGFRLHFP-ARFELVGDHRASRQG-STEQQNSMERLP----------RQ
A0A3Q1FVH7_BMF-01      NAGFRLHFP-AHFELI----ARQQG-SEMEQNGMEQLP----------RQ
A0A3Q1FVH7_BMF-02      NAGFRLHFP-AHFELI----ARQQG-SEMEQNGMEQLP----------RQ
A0A3Q1D1K3_BMF-01      NAGFRLHFP-ARFELIGNHQARQQG-SEMEQNGMEQLP----------RQ
A0A3P8RKY9_BMF-01      NAGFRLHFP-ARFELIGNHQARQQG-SEMEQNGMEQLP----------RQ
A0A3Q1IPR4_BMF-01      NAGFRLHFP-AHFELVGDLEVRQQD-SEEEQNGMEIPP----------RQ
A0A3B4U5H8_BMF-01      NAGFRLHFP-AHFELVGDQEARRQG-SGEERNGMEQLP----------RQ
A0A3B4WM88_BMF-01      NAGFRLHFP-AHFELVGDQEARRQG-SGEERNGMEQLP----------RQ
A0A3Q3RVI2_BMF-01      NAGFRLHFP-AHFELVGDQEVRQQE-REEEQNRMEQLP----------RQ
A0A3Q3RVI2_BMF-02      NAGFRLHFP-AHFELVGDQEVRQQE-REEEQNRMEQLP----------RQ
A0A3Q3VLX6_BMF-01      TSSLAPDS---------------RD-NCRERNGMERLP----------RQ
A0A3B5KWG6_BMF-01      EAGDTLHY---------------TG-GA--PNGMEPLP----------QQ
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A452H3N6_BMF-01      GQRE-ALAEVQIARKLQCIADQFHRLHIQR--------------------
A0A287AIU8_BMF-02      GQWQ-HRAEVQIARKLQCIADQFHRLHMQQ--------------------
G1PAU1_BMF-01          GQWQHHRAEIQIARKLQSIADQFHRLQMQQ--------------------
A0A287AIU8_BMF-01      GQWQ-HRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A1U8CPE0_BMF-02      GQWQ-HRAEVQIARKLQCIADQFHRLHIQQ--------------------
A0A286XXB0_BMF-03      GQWQ-HRAEVQIARKLQCIADQFHRLHIQQ--------------------
A0A287CXH0_BMF-02      GQWQ-HRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A1S3EQA2_BMF-02      G----HRVEVQIARKLQCIADQFHRLHTQR--------------------
A2AV74_BMF-02          GQFLQHRAEVQIARKLQCIADQFHRLHTQQ--------------------
A0A337ST43_BMF-02      PGF-ECRREQEWGRSQVRLGCPPRMGHHRK--------------------
A0A2K5KGP2_BMF-01      PCF-EWRREQERGGPQVRLGCPLHMGHQEH--------------------
A0A2K6FFN3_BMF-02      PCF-ERRREQERGRSQ----------------------------------
A0A2K5E1Q4_BMF-02      PGF-EWRREQEWGRPE----------------------------------
A0A2K5RN49_BMF-02      PGF-EWRREQEWGRPE----------------------------------
A0A2K6TW78_BMF-03      PGF-EWRRKQEWGRSE----------------------------------
A0A2K6RAW1_BMF-02      PCF-EWRRE-----------------------------------------
A0A2I2Z168_BMF-02      PCF-EWRREQERGRP-----------------------------------
A0A2R9BS98_BMF-02      PCF-EWRREQERGRP-----------------------------------
A0A2J8QDD5_BMF-01      PCF-EWRREQERGRP-----------------------------------
A0A2K5MJW4_BMF-01      PCF-EWRREQERGGP-----------------------------------
A0A2K5VLE9_BMF-01      PCF-EWRREQERGGP-----------------------------------
A0A2K6B5F6_BMF-03      PCF-EWRREQERGGP-----------------------------------
A0A2K5Z4A9_BMF-02      PCF-EWRREQERGGP-----------------------------------
A0A096NTE9_BMF-03      PCF-EWRREQERGGP-----------------------------------
A0A2I3HD83_BMF-01      PCF-EWRREQEWGRP-----------------------------------
A0A1S3EQA2_BMF-01      G----HRVEVQIARKLQCIADQFHRLHTQR--------------------
Q8K589_BMF-01          GQFLQHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A337ST43_BMF-04      GHW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A337ST43_BMF-05      GHW-QHRAEVQIARKLQCIADQFHRLHMQQVGMGAWGGGRVCWGWGARTC
A2AV74_BMF-01          GQFLQHRAEVQIARKLQCIADQFHRLHTQQ--------------------
A0A286XXB0_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHIQQ--------------------
G3WDQ2_BMF-01          EQW-EHRAEVQIARKLQCIADQFHRLHMQR--------------------
G3T7Z4_BMF-01          GQW-QHRAEVQIARKLQCIADHFHRLHMQR--------------------
A0A287CXH0_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A1S3WU31_BMF-01      GQW-QQRVEVQIARKLQCIADQFHHLHMQQ--------------------
A0A1U8CPE0_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHIQQ--------------------
G1SR62_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHLQQ--------------------
M3YAD5_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
U6CSY8_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A452SED0_BMF-01      GPW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A384D070_BMF-01      GPW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
W5QFV1_BMF-01          GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
L8IXF5_BMF-01          GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
A0A452F2E0_BMF-01      GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
A0A452F2E0_BMF-02      GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
Q05KI3_BMF-01          GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
Q05KI3_BMF-02          GQW-QHRAEIQIARKLQCIADQFHRLHMQQ--------------------
A0A2K6FFN3_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
H0WYH6_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A096NTE9_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6L919_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5E1Q4_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6TW78_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6TW78_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5RN49_BMF-01      GQW-QHRAEVQIARKLQCIADQFHQLHVQQ--------------------
A0A2I2Z168_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2R9BS98_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2J8QDD5_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2J8T301_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
F7CM09_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5MJW4_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5KGP2_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5VLE9_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
F7CM09_BMF-02          GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
F7CM09_BMF-03          GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6B5F6_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6B5F6_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6B5F6_BMF-04      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K5Z4A9_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6L919_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6L919_BMF-03      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A2K6RAW1_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A0D9R4R5_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHVQQ--------------------
A0A337ST43_BMF-01      GHW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A337ST43_BMF-03      GHW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A3Q2HR24_BMF-02      GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A3Q2HR24_BMF-01      GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
J9PB65_BMF-03          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
J9PB65_BMF-04          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
J9PB65_BMF-02          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
J9PB65_BMF-01          GQW-QHRAEVQIARKLQCIADQFHRLHMQQ--------------------
A0A493T7X1_BMF-01      EQE-PHWAEVSFTHLFQATSSLQGALNKHW--------------------
H9GL49_BMF-01          SPQ-ELRTEVQIARKLQCIADQFHRLHLQR--------------------
A0A3Q2UCA0_BMF-01      GQR-EARTEVQIARKLQCIADQFHRLHIQR--------------------
A0A3Q2UCA0_BMF-02      GQR-EARTEVQIARKLQCIADQFHRLHIQR--------------------
K7FRX2_BMF-01          GHQ-EARAEVQIARKLQCIADQFHRLHIQR--------------------
U3JS06_BMF-01          GQR-EARAEVQIARKLQCIADQFHRLHIQR--------------------
H0ZMX5_BMF-01          GQR-EARAEVQIARKLQCIADQFHRLHIQR--------------------
A0A493T7X1_BMF-02      GQQ-EARAEVQIARKLQCIADQFHRLHIQR--------------------
A0A3Q2UCA0_BMF-03      GQR-EARTEVQIARKLQCIADQFHRLHIQR--------------------
A0A3Q2UCA0_BMF-04      GQR-EARTEVQIARKLQCIADQFHRLHIQR--------------------
G1NHG8_BMF-01          GQR-EARTEVQIARKLQCIADQFHRLHIQR--------------------
A0A3B4UNJ0_BMF-01      ---AGVSVEAQIGRKLREIGDKFQQDHF----------------------
A0A3B4B6Y3_BMF-01      PV-AVRSMEACIGHKLQLIGDQFHRDHLQR--------------------
A0A3P9ICE1_BMF-01      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
Q0GKC7_BMF-01          EPRPAQSVETLIGQKLQLIGDQFYQEHI----------------------
A0A3B3RH63_BMF-01      DR-PQPSAEVRIGQKLQMIGDQFHQDQLQL--------------------
W5N4P7_BMF-01          EQ-PVRSAEVRIGQKLQRIGDQFHRDYLHM--------------------
A0A3B1K1X5_BMF-01      RP--AHSVEARIGQKLQMIGDQFYQEHMLQ--------------------
A0A3B4CNJ8_BMF-01      RP--PHSVEARIGQKLQMIGDQFYQEHMLQ--------------------
A0A2U9CJH3_BMF-01      QP-VAHSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q2YCX7_BMF-01      QP-VARSIEACVGQKLQLIGDQFHREHLQL--------------------
A0A3Q2YCX7_BMF-02      QP-VARSIEACVGQKLQLIGDQFHREHLQL--------------------
A0A3P8ZIE7_BMF-01      QL-PQQPVARCIGQKLQLIGDQFHEEHLQL--------------------
A0A3Q3QZ16_BMF-01      QR-VARSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q3QZ16_BMF-02      QR-VARSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q2PJX9_BMF-02      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3Q2PJX9_BMF-01      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3Q2PJX9_BMF-03      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3B5QK08_BMF-01      QP-AALSLEASIGQKLQLIGDQFHREHLQQ--------------------
A0A3B5QK08_BMF-02      QP-AALSLEASIGQKLQLIGDQFHREHLQQ--------------------
A0A096LRV0_BMF-01      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3B3WU80_BMF-01      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3P9Q8E2_BMF-01      QP-AALSLEACIGQKLQLIGDQFHREHLQQ--------------------
A0A3Q2CXC4_BMF-01      QP-AALSLEACIGQKLQIIGDQFHREHLQQ--------------------
A0A3Q2CXC4_BMF-02      QP-AALSLEACIGQKLQIIGDQFHREHLQQ--------------------
A0A3Q3GUU5_BMF-01      QP-VAHSVEASIGLKLQLIGDQFHREHLQL--------------------
A0A3B5B8F6_BMF-01      QP-VARSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3P8UA78_BMF-02      QP-VQRSVEVRIGQKLQLIGDQFHRDHLQL--------------------
A0A3P8UA78_BMF-01      QP-VQRSVEVRIGQKLQLIGDQFHRDHLQL--------------------
A0A3P8UA78_BMF-03      QP-VQRSVEVRIGQKLQLIGDQFHRDHLQL--------------------
A0A3B3CGR9_BMF-01      QP-AARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3P9K487_BMF-02      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3P9K487_BMF-01      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3B3HAU1_BMF-01      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3B3HAU1_BMF-03      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3B3HAU1_BMF-02      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3B3HAU1_BMF-04      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3P9ICE1_BMF-04      QP-VARSTEACIAQKLQLIGDQFHRERLQL--------------------
A0A3Q2ZA20_BMF-01      LP-VARSLEVCIGQKLQLIGDQFHREHLQQ--------------------
A0A3P8NFE2_BMF-02      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
I3K2D6_BMF-01          RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3P8NFE2_BMF-01      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3Q3C5V2_BMF-01      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3P9DPJ5_BMF-02      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3P9DPJ5_BMF-01      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3B4ETH0_BMF-01      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3Q4G1I4_BMF-01      RP-AARSVEACIGQKLQLIGDQFHWERLQL--------------------
A0A3Q1FVH7_BMF-01      QP-MAHSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q1FVH7_BMF-02      QP-MAHSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q1D1K3_BMF-01      QP-VARSMEACIGQKLQLIGDQFHREHLQL--------------------
A0A3P8RKY9_BMF-01      QP-VARSMEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q1IPR4_BMF-01      QP-LMQSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3B4U5H8_BMF-01      QP-VARSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3B4WM88_BMF-01      QP-VARSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q3RVI2_BMF-01      QP-LVHSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q3RVI2_BMF-02      QP-LVHSVEACIGQKLQLIGDQFHREHLQL--------------------
A0A3Q3VLX6_BMF-01      QP-VAHSVEACIGQKLQLIGDQFHREHMQL--------------------
A0A3B5KWG6_BMF-01      GP-VVRSTEACIGQKLQLIGDQFHRERVQL--------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A452H3N6_BMF-01      ---------H------QQNR---N------Q-------------------
A0A287AIU8_BMF-02      ---------H------QQNQ---N------R-------------------
G1PAU1_BMF-01          ---------H------QQNR---N------R-------------------
A0A287AIU8_BMF-01      ---------H------QQNQ---N------R-------------------
A0A1U8CPE0_BMF-02      ---------H------QQNR---D------R-------------------
A0A286XXB0_BMF-03      ---------H------QQNR---N------R-------------------
A0A287CXH0_BMF-02      ---------H------QQNR---N------R-------------------
A0A1S3EQA2_BMF-02      ---------H------QQHR---D------R-------------------
A2AV74_BMF-02          ---------H------QQNR---D------R-------------------
A0A337ST43_BMF-02      ---------D------ISED------------------------------
A0A2K5KGP2_BMF-01      ---------R------QEGHRAGL------T-------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      ---------H------QQHR---D------R-------------------
Q8K589_BMF-01          ---------H------QQNR---D------R-------------------
A0A337ST43_BMF-04      ---------H------QQNR---R------R-------------------
A0A337ST43_BMF-05      LSNSVSARLY------QDMV---P------E-------------------
A2AV74_BMF-01          ---------H------QQNR---D------R-------------------
A0A286XXB0_BMF-02      ---------H------QQNR---N------R-------------------
G3WDQ2_BMF-01          ---------H------QQNQ---N------H-------------------
G3T7Z4_BMF-01          ---------H------QQNR---N------P-------------------
A0A287CXH0_BMF-01      ---------H------QQNR---N------R-------------------
A0A1S3WU31_BMF-01      ---------H------QQNR---N------P-------------------
A0A1U8CPE0_BMF-01      ---------H------QQNR---D------R-------------------
G1SR62_BMF-01          ---------H------QQNR---N------R-------------------
M3YAD5_BMF-01          ---------H------QQNQ---N------R-------------------
U6CSY8_BMF-01          ---------H------QQNQ---N------R-------------------
A0A452SED0_BMF-01      ---------H------QQNQ---N------R-------------------
A0A384D070_BMF-01      ---------H------QQNQ---N------R-------------------
W5QFV1_BMF-01          ---------H------QQNR---N------R-------------------
L8IXF5_BMF-01          ---------Y------QQNR---N------R-------------------
A0A452F2E0_BMF-01      ---------H------QQNR---N------R-------------------
A0A452F2E0_BMF-02      ---------H------QQNR---N------R-------------------
Q05KI3_BMF-01          ---------Y------QQNR---N------R-------------------
Q05KI3_BMF-02          ---------Y------QQNR---N------R-------------------
A0A2K6FFN3_BMF-01      ---------H------QQNQ---N------R-------------------
H0WYH6_BMF-01          ---------H------QQNQ---N------R-------------------
A0A096NTE9_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K6L919_BMF-02      ---------H------QQNR---N------R-------------------
A0A2K5E1Q4_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K6TW78_BMF-02      ---------H------QQNR---N------R-------------------
A0A2K6TW78_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K5RN49_BMF-01      ---------H------QQNR---N------R-------------------
A0A2I2Z168_BMF-01      ---------H------QQNQ---N------R-------------------
A0A2R9BS98_BMF-01      ---------H------QQNQ---N------R-------------------
A0A2J8QDD5_BMF-02      ---------H------QQNQ---N------R-------------------
A0A2J8T301_BMF-01      ---------H------QQNR---N------R-------------------
F7CM09_BMF-01          ---------H------QQNR---N------R-------------------
A0A2K5MJW4_BMF-02      ---------H------QQNR---N------R-------------------
A0A2K5KGP2_BMF-02      ---------H------QQNR---N------R-------------------
A0A2K5VLE9_BMF-02      ---------H------QQNR---N------R-------------------
F7CM09_BMF-02          ---------H------QQNR---N------R-------------------
F7CM09_BMF-03          ---------H------QQNR---N------R-------------------
A0A2K6B5F6_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K6B5F6_BMF-02      ---------H------QQNR---N------R-------------------
A0A2K6B5F6_BMF-04      ---------H------QQNR---N------R-------------------
A0A2K5Z4A9_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K6L919_BMF-01      ---------H------QQNR---N------R-------------------
A0A2K6L919_BMF-03      ---------H------QQNR---N------R-------------------
A0A2K6RAW1_BMF-01      ---------H------QQNR---N------R-------------------
A0A0D9R4R5_BMF-01      ---------H------QQNR---N------R-------------------
A0A337ST43_BMF-01      ---------H------QQNR---R------R-------------------
A0A337ST43_BMF-03      ---------V------GMGAWGGG------R-------------------
A0A3Q2HR24_BMF-02      ---------H------QQNR---N------R-------------------
A0A3Q2HR24_BMF-01      ---------H------QQNR---N------R-------------------
J9PB65_BMF-03          ---------H------QQNQ---N------R-------------------
J9PB65_BMF-04          ---------H------QQNQ---N------R-------------------
J9PB65_BMF-02          ---------H------QQNQ---N------R-------------------
J9PB65_BMF-01          ---------H------QQNQ---N------R-------------------
A0A493T7X1_BMF-01      ---------F------GGET---C------TPPAGCEDSEILLLVFKFGV
H9GL49_BMF-01          ---------H------QQNR---N------Q-------------------
A0A3Q2UCA0_BMF-01      ---------V------GCFH---R------G-------------------
A0A3Q2UCA0_BMF-02      ---------V------GCFH---R------G-------------------
K7FRX2_BMF-01          ---------H------QQNR---N------Q-------------------
U3JS06_BMF-01          ---------H------QQNR---N------Q-------------------
H0ZMX5_BMF-01          ---------H------QQNR---N------Q-------------------
A0A493T7X1_BMF-02      ---------H------QQNR---N------Q-------------------
A0A3Q2UCA0_BMF-03      ---------H------QQNR---N------Q-------------------
A0A3Q2UCA0_BMF-04      ---------H------QQNR---N------Q-------------------
G1NHG8_BMF-01          ---------H------QQNR---N------Q-------------------
A0A3B4UNJ0_BMF-01      ----------------MRHQRQNL------P-------------------
A0A3B4B6Y3_BMF-01      ---------V------REH-------------------------------
A0A3P9ICE1_BMF-01      ---------Y------HRNQRNQG------P-------------------
Q0GKC7_BMF-01          ----------------MHHQRPQD------P-------------------
A0A3B3RH63_BMF-01      ---------Y------HRNQRNQQ------P-------------------
W5N4P7_BMF-01          ---------Y------RRNQRNHQ------P-------------------
A0A3B1K1X5_BMF-01      ----------------HRNQRNQQ------P-------------------
A0A3B4CNJ8_BMF-01      ----------------HRNQRNQQ------P-------------------
A0A2U9CJH3_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q2YCX7_BMF-01      ---------V------SRNQHKHK--------------------------
A0A3Q2YCX7_BMF-02      ---------V------SRNQHKHK--------------------------
A0A3P8ZIE7_BMF-01      ---------Y------HRNQRNLR------P-------------------
A0A3Q3QZ16_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q3QZ16_BMF-02      ---------Y------HRNQRNQG------P-------------------
A0A3Q2PJX9_BMF-02      ---------R------GSFRSSLAAGEVGKP-------------------
A0A3Q2PJX9_BMF-01      ---------Y------HQNQRNQG------P-------------------
A0A3Q2PJX9_BMF-03      ---------Y------HQNQRNQG------P-------------------
A0A3B5QK08_BMF-01      ---------Y------QQNQRNQG------P-------------------
A0A3B5QK08_BMF-02      ---------Y------QQNQRNQG------P-------------------
A0A096LRV0_BMF-01      ---------Y------QQNQRNQG------P-------------------
A0A3B3WU80_BMF-01      ---------Y------QQNQRNQG------P-------------------
A0A3P9Q8E2_BMF-01      ---------Y------QQNQRNQG------P-------------------
A0A3Q2CXC4_BMF-01      ---------Y------HQNQRNQG------P-------------------
A0A3Q2CXC4_BMF-02      ---------IPGQPFPHLVHQHQALTLPPLP-------------------
A0A3Q3GUU5_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B5B8F6_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3P8UA78_BMF-02      ---------Y------HRNQRNHG------P-------------------
A0A3P8UA78_BMF-01      ---------Y------HRNQRNHG------P-------------------
A0A3P8UA78_BMF-03      ---------Y------HRNQRNHG------P-------------------
A0A3B3CGR9_BMF-01      ---------Y------HQNQRNQG------P-------------------
A0A3P9K487_BMF-02      ---------Y------HRNQRNQG------P-------------------
A0A3P9K487_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B3HAU1_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B3HAU1_BMF-03      ---------Y------HRNQRNQG------P-------------------
A0A3B3HAU1_BMF-02      ---------Y------HRNQRNQG------P-------------------
A0A3B3HAU1_BMF-04      ---------Y------HRNQRNQG------P-------------------
A0A3P9ICE1_BMF-04      ---------Y------HRNQRNQG------P-------------------
A0A3Q2ZA20_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3P8NFE2_BMF-02      ---------V------KASRIQT---------------------------
I3K2D6_BMF-01          ---------Y------HRNQRNQG------P-------------------
A0A3P8NFE2_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q3C5V2_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3P9DPJ5_BMF-02      ---------Y------HRNQRNQG------P-------------------
A0A3P9DPJ5_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B4ETH0_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q4G1I4_BMF-01      ---------Y------QRNQRNQG------P-------------------
A0A3Q1FVH7_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q1FVH7_BMF-02      ---------Y------HRNQRNQG------P-------------------
A0A3Q1D1K3_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3P8RKY9_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3Q1IPR4_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B4U5H8_BMF-01      ---------Y------HQNQRNQG------P-------------------
A0A3B4WM88_BMF-01      ---------Y------HQNQRNHG------P-------------------
A0A3Q3RVI2_BMF-01      -----------------------Q------V-------------------
A0A3Q3RVI2_BMF-02      ---------Y------HLNQRNQG------L-------------------
A0A3Q3VLX6_BMF-01      ---------Y------HRNQRNQG------P-------------------
A0A3B5KWG6_BMF-01      ---------Y------QRNQRNQG------P-------------------
A9XRH0_BMF-01          ----------------RHQQNRNQ--------------------------
A3KND0_BMF-01          ----------------KEALS-----------------------------
                                                                         

A0A452H3N6_BMF-01      VWW-----------------QILLFI------HNLALNVEVNRNHVGQR-
A0A287AIU8_BMF-02      VWW-----------------QILLFL------HNLALHGDENRNGAGPR-
G1PAU1_BMF-01          MWW-----------------QFLLFL------HNLALNGDENRNGAGPR-
A0A287AIU8_BMF-01      VWW-----------------QILLFL------HNLALHGDENRNGAGPR-
A0A1U8CPE0_BMF-02      AWW-----------------QVFLFL------QNLALNREENREGVGPW-
A0A286XXB0_BMF-03      AWW-----------------QVLLFM------HNLGLNGEENREGAGPR-
A0A287CXH0_BMF-02      VWW-----------------QILLFL------HNLALNGDENRDRAGPR-
A0A1S3EQA2_BMF-02      AWG-----------------QVLLFL------HNLALNR-ENRDRAGPR-
A2AV74_BMF-02          AWW-----------------QVFLFL------QNLALNRQENREGVGPW-
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      LCL-----------------VKLFFC------CYFAF-------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      AWG-----------------QVLLFL------HNLALN-RENRDRAGPR-
Q8K589_BMF-01          AWR-----------------QVFLFL------QNLALNRRENREGVGPW-
A0A337ST43_BMF-04      VWW-----------------QILLFL------HNLALNAEENRNGAGPR-
A0A337ST43_BMF-05      FWP-----------------RLL---------------------------
A2AV74_BMF-01          AWW-----------------QVFLFL------QNLALNRQENREGVGPW-
A0A286XXB0_BMF-02      AWW-----------------QVLLFM------HNLGLNGEENREGAGPR-
G3WDQ2_BMF-01          VWW-----------------QILLFL------HNLALNREENRNGAGPR-
G3T7Z4_BMF-01          AWR-----------------QILQFL------HHLAVNGEENRNGAGPR-
A0A287CXH0_BMF-01      VWW-----------------QILLFL------HNLALNGDENRDRAGPR-
A0A1S3WU31_BMF-01      VWW-----------------PFLLFL------HNLALNEGENRNREAPR-
A0A1U8CPE0_BMF-01      AWW-----------------QVFLFL------QNLALNREENREGVGPW-
G1SR62_BMF-01          VWW-----------------QILLFL------HNLALNGDENRDGAGPR-
M3YAD5_BMF-01          VWW-----------------QILLFL------HNLALNADENRNGAGPR-
U6CSY8_BMF-01          VWW-----------------QILLFL------HNLALNADGNRNGAGPR-
A0A452SED0_BMF-01      VWW-----------------QILLFL------HNLALNADENRDGAGPR-
A0A384D070_BMF-01      VWW-----------------QILLFL------HNLALNADENRDGAGPR-
W5QFV1_BMF-01          MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
L8IXF5_BMF-01          MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
A0A452F2E0_BMF-01      MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
A0A452F2E0_BMF-02      MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
Q05KI3_BMF-01          MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
Q05KI3_BMF-02          MWW-----------------QILLFL------HNVALNGDENRNGAGPR-
A0A2K6FFN3_BMF-01      MWW-----------------QILLFL------HNLALNGEENRNGAGPR-
H0WYH6_BMF-01          VWW-----------------QVLFFL------HNLALNGEENRNGAGPR-
A0A096NTE9_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGVDPRY
A0A2K6L919_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPRP
A0A2K5E1Q4_BMF-01      VWW-----------------QVLLFL------HNLALNGEENRNGAGPR-
A0A2K6TW78_BMF-02      VWW-----------------QVLLFL------HNLALNGEENRNGAGPR-
A0A2K6TW78_BMF-01      VWW-----------------QVLLFL------HNLALNGEENRNGAGPR-
A0A2K5RN49_BMF-01      VWW-----------------QVLLFL------HNLALNGEENRNGAGLR-
A0A2I2Z168_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2R9BS98_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2J8QDD5_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2J8T301_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
F7CM09_BMF-01          VWW-----------------QILLFL------HNLALNGEQNRNGAGPRP
A0A2K5MJW4_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K5KGP2_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K5VLE9_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
F7CM09_BMF-02          VWW-----------------QILLFL------HNLALNGEQNRNGAGPR-
F7CM09_BMF-03          VWW-----------------QILLFL------HNLALNGEQNRNGAGPR-
A0A2K6B5F6_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K6B5F6_BMF-02      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K6B5F6_BMF-04      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K5Z4A9_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K6L919_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K6L919_BMF-03      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A2K6RAW1_BMF-01      VWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A0D9R4R5_BMF-01      MWW-----------------QILLFL------HNLALNGEENRNGAGPR-
A0A337ST43_BMF-01      VWW-----------------QILLFL------HNLALNAEENRNGAGPRT
A0A337ST43_BMF-03      VCW-----------------------------------------GWGART
A0A3Q2HR24_BMF-02      VWW-----------------QTLLFL------HNLALNGDENRNGAGPRC
A0A3Q2HR24_BMF-01      VWW-----------------QTLLFL------HNLALNGDENRNGAGPSF
J9PB65_BMF-03          VWW-----------------QILLFL------HNLALNADENRNGAGPS-
J9PB65_BMF-04          VWW-----------------QILLFL------HNLALNADENRNGAGPR-
J9PB65_BMF-02          VWW-----------------QILLFL------HNLALNADENRNGAGPS-
J9PB65_BMF-01          VWW-----------------QILLFL------HNLALNADENRNGAGPS-
A0A493T7X1_BMF-01      LWT-----------------PLCCSLPCEAGSSCPTLSKESQNVGVFGKA
H9GL49_BMF-01          VWW-----------------QIFFFL------HNVALNMEANRHRAGRSC
A0A3Q2UCA0_BMF-01      RWG-----------------LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
A0A3Q2UCA0_BMF-02      RWG-----------------LSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
K7FRX2_BMF-01          VWW-----------------QILLFL------HNLALNVEANRNHIGQR-
U3JS06_BMF-01          VWW-----------------QLFLFL------HNLALNTEVNRNHTGQR-
H0ZMX5_BMF-01          VWW-----------------QLFLFL------HNLALNTEVNRNHTGQR-
A0A493T7X1_BMF-02      VWW-----------------QLFLFL------HNLALNVEANRNHTGQR-
A0A3Q2UCA0_BMF-03      VWW-----------------QLFLFL------HNLALNVEANRNRTGQR-
A0A3Q2UCA0_BMF-04      VWW-----------------QLFLFL------HNLALNVEANRNRTGQR-
G1NHG8_BMF-01          VWW-----------------QLFLFL------HNLALNVEANRNRTGQR-
A0A3B4UNJ0_BMF-01      AWM-----------------RLTMAL------FGFLFPRQALVPRLRGEQ
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
Q0GKC7_BMF-01          LWR-----------------RVATAV------LTLLFGA--------REN
A0A3B3RH63_BMF-01      VWW-----------------RLVMAL------CGLLFER------RQRAE
W5N4P7_BMF-01          MWW-----------------RLALAL------FTFLFERQGNRNQLRGDQ
A0A3B1K1X5_BMF-01      LWL-----------------RLASAL------YTLLFER-EPAAHGRRED
A0A3B4CNJ8_BMF-01      FWL-----------------RLASAL------YTLLFER-EPVANGRRVD
A0A2U9CJH3_BMF-01      LWW-----------------RLAAAL------LSLLFDR-GFLAGGGGAG
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      LWW-----------------RLASAL------LTLLWEQ-EAVAGGGRAG
A0A3Q3QZ16_BMF-01      LWW-----------------RLATTL------LSLLFDR-GFIAGGGGAG
A0A3Q3QZ16_BMF-02      LWW-----------------RLATTL------LSLLFDR-GFIAGGGGAG
A0A3Q2PJX9_BMF-02      MYYTNVYSQCPTCWLANCLSRLAAEL------LILCEFP-TLL-------
A0A3Q2PJX9_BMF-01      LWW-----------------RMTAAL------LSLLLDR-GFVAGRGGAG
A0A3Q2PJX9_BMF-03      LWW-----------------RMTAAL------LSLLLDR-GFVAGRGGAG
A0A3B5QK08_BMF-01      LWW-----------------RMTAAL------LSLLFDR-GFIAGGGGAG
A0A3B5QK08_BMF-02      LWW-----------------RMTAAL------LSLLFDR-GFIAGGGGAG
A0A096LRV0_BMF-01      LWW-----------------RMTAAL------LSLLFHR-GFIAGGGGAG
A0A3B3WU80_BMF-01      LWW-----------------RMTAAL------LSLLFHR-GFIAGGGGAG
A0A3P9Q8E2_BMF-01      LWW-----------------RMTAAL------LSLLFDR-GFIAGGGGAG
A0A3Q2CXC4_BMF-01      LWW-----------------RMTAAL------LSLLFDR-GLIGGAGWR-
A0A3Q2CXC4_BMF-02      VYF-----------------SLLSPV------VPL-------CCGGKWH-
A0A3Q3GUU5_BMF-01      LWW-----------------RLGAAL------LSLLFDR-GFIA---GAG
A0A3B5B8F6_BMF-01      LWW-----------------RLAAAL------LSLLFDR-GFIAGGGGAG
A0A3P8UA78_BMF-02      LWW-----------------RLTTTL------LSLLFNR-GFFAGGGAAG
A0A3P8UA78_BMF-01      LWW-----------------RLTTTL------LSLLFNR-GFFAGGGAAG
A0A3P8UA78_BMF-03      LWW-----------------RLTTTL------LSLLFNR-GFFAGGGAAG
A0A3B3CGR9_BMF-01      LWW-----------------RLTTAL------VSLLLDR-GFIAGGGGAG
A0A3P9K487_BMF-02      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3P9K487_BMF-01      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3B3HAU1_BMF-01      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3B3HAU1_BMF-03      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3B3HAU1_BMF-02      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3B3HAU1_BMF-04      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3P9ICE1_BMF-04      VWW-----------------RLATAL------VSLLFDR-GFIAGAGGAG
A0A3Q2ZA20_BMF-01      LWW-----------------RLTAAL------LSLLFDR-GFIAGGGGAG
A0A3P8NFE2_BMF-02      CWL-----------------ETAEAY------ATPCKVHHSVITVWKPRG
I3K2D6_BMF-01          MWW-----------------RLAAAL------LSLLFDR-GFIAGGGGGG
A0A3P8NFE2_BMF-01      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3Q3C5V2_BMF-01      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3P9DPJ5_BMF-02      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3P9DPJ5_BMF-01      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3B4ETH0_BMF-01      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3Q4G1I4_BMF-01      MWW-----------------RLAAAI------LSLLFDR-GFIAGGGGGG
A0A3Q1FVH7_BMF-01      LWW-----------------RLVAAI------LSLLFDG-GFIAGGGGAG
A0A3Q1FVH7_BMF-02      LWW-----------------RLVAAI------LSLLFDG-GFIAGGGGAG
A0A3Q1D1K3_BMF-01      LWW-----------------RLAAAV------LSLLFDR-GFIAGGGGAG
A0A3P8RKY9_BMF-01      LWW-----------------RLAAAV------LSLLFDR-GFIAGGGGAG
A0A3Q1IPR4_BMF-01      LWW-----------------RLAAAM------LSLLFDR-GLIAGGGGAG
A0A3B4U5H8_BMF-01      LWW-----------------RLAVAL------LSLLFDR-GLIAGGGGAG
A0A3B4WM88_BMF-01      LWW-----------------RLAAAL------LSLLFDR-GLIAGGGGAG
A0A3Q3RVI2_BMF-01      GWA-----------------PETSGS------LPVLLACLTLITGVWREG
A0A3Q3RVI2_BMF-02      LWW-----------------RLATAL------LSLLFDR-GFIAGGGRAG
A0A3Q3VLX6_BMF-01      LWW-----------------RLGSAL------LSLLFDR-GFFAGGGGAG
A0A3B5KWG6_BMF-01      LWW-----------------RLGTAL------LSLLFDR-GFVAGGGGAG
A9XRH0_BMF-01          VWW-----------------QLFLFL------HNLALNVEANRNRTGQR-
A3KND0_BMF-01          --------------------EIYRMF------NASIPHESHRFHRLFQV-
                                                                         

A0A452H3N6_BMF-01      --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
G1PAU1_BMF-01          --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-02      --------------------------------------------------
A0A286XXB0_BMF-03      --------------------------------------------------
A0A287CXH0_BMF-02      --------------------------------------------------
A0A1S3EQA2_BMF-02      --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
A0A337ST43_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-01      --------------------------------------------------
A0A2K6FFN3_BMF-02      --------------------------------------------------
A0A2K5E1Q4_BMF-02      --------------------------------------------------
A0A2K5RN49_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-02      --------------------------------------------------
A0A2I2Z168_BMF-02      --------------------------------------------------
A0A2R9BS98_BMF-02      --------------------------------------------------
A0A2J8QDD5_BMF-01      --------------------------------------------------
A0A2K5MJW4_BMF-01      --------------------------------------------------
A0A2K5VLE9_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-03      --------------------------------------------------
A0A2K5Z4A9_BMF-02      --------------------------------------------------
A0A096NTE9_BMF-03      --------------------------------------------------
A0A2I3HD83_BMF-01      --------------------------------------------------
A0A1S3EQA2_BMF-01      --------------------------------------------------
Q8K589_BMF-01          --------------------------------------------------
A0A337ST43_BMF-04      --------------------------------------------------
A0A337ST43_BMF-05      --------------------------------------------------
A2AV74_BMF-01          --------------------------------------------------
A0A286XXB0_BMF-02      --------------------------------------------------
G3WDQ2_BMF-01          --------------------------------------------------
G3T7Z4_BMF-01          --------------------------------------------------
A0A287CXH0_BMF-01      --------------------------------------------------
A0A1S3WU31_BMF-01      --------------------------------------------------
A0A1U8CPE0_BMF-01      --------------------------------------------------
G1SR62_BMF-01          --------------------------------------------------
M3YAD5_BMF-01          --------------------------------------------------
U6CSY8_BMF-01          --------------------------------------------------
A0A452SED0_BMF-01      --------------------------------------------------
A0A384D070_BMF-01      --------------------------------------------------
W5QFV1_BMF-01          --------------------------------------------------
L8IXF5_BMF-01          --------------------------------------------------
A0A452F2E0_BMF-01      --------------------------------------------------
A0A452F2E0_BMF-02      --------------------------------------------------
Q05KI3_BMF-01          --------------------------------------------------
Q05KI3_BMF-02          --------------------------------------------------
A0A2K6FFN3_BMF-01      --------------------------------------------------
H0WYH6_BMF-01          --------------------------------------------------
A0A096NTE9_BMF-01      KNARRSVRKLKASSFLSCQPE-----------------------------
A0A2K6L919_BMF-02      LTWNGGRCQTLLKGRLMCL-------------------------------
A0A2K5E1Q4_BMF-01      --------------------------------------------------
A0A2K6TW78_BMF-02      --------------------------------------------------
A0A2K6TW78_BMF-01      --------------------------------------------------
A0A2K5RN49_BMF-01      --------------------------------------------------
A0A2I2Z168_BMF-01      --------------------------------------------------
A0A2R9BS98_BMF-01      --------------------------------------------------
A0A2J8QDD5_BMF-02      --------------------------------------------------
A0A2J8T301_BMF-01      --------------------------------------------------
F7CM09_BMF-01          LTWNGAVVKPC---------------------------------------
A0A2K5MJW4_BMF-02      --------------------------------------------------
A0A2K5KGP2_BMF-02      --------------------------------------------------
A0A2K5VLE9_BMF-02      --------------------------------------------------
F7CM09_BMF-02          --------------------------------------------------
F7CM09_BMF-03          --------------------------------------------------
A0A2K6B5F6_BMF-01      --------------------------------------------------
A0A2K6B5F6_BMF-02      --------------------------------------------------
A0A2K6B5F6_BMF-04      --------------------------------------------------
A0A2K5Z4A9_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-01      --------------------------------------------------
A0A2K6L919_BMF-03      --------------------------------------------------
A0A2K6RAW1_BMF-01      --------------------------------------------------
A0A0D9R4R5_BMF-01      --------------------------------------------------
A0A337ST43_BMF-01      SPGMRAFVKHC---------------------------------------
A0A337ST43_BMF-03      CLSNSVSARLYQDMVPEFWPRLL---------------------------
A0A3Q2HR24_BMF-02      GKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLS--WS---------
A0A3Q2HR24_BMF-01      QPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL--------
J9PB65_BMF-03          ------------------FQLVPGISCSGAQQDCSCL-------------
J9PB65_BMF-04          --------------------------------------------------
J9PB65_BMF-02          -----------QSLQIRFWRLSRNLPCSLRSKTTTPQD-G----------
J9PB65_BMF-01          -----------QSLQIRFWRLSRNLPCSLRRPATRIRSLG----------
A0A493T7X1_BMF-01      CCWVPAPVTSVQERQVLG--------------------------------
H9GL49_BMF-01          TTTYFPFTEPPVCFPFSEMLPRFCLEAI----------------------
A0A3Q2UCA0_BMF-01      --------------------------------------------------
A0A3Q2UCA0_BMF-02      --------------------------------------------------
K7FRX2_BMF-01          --------------------------------------------------
U3JS06_BMF-01          --------------------------------------------------
H0ZMX5_BMF-01          --------------------------------------------------
A0A493T7X1_BMF-02      --------------------------------------------------
A0A3Q2UCA0_BMF-03      --------------------------------------------------
A0A3Q2UCA0_BMF-04      --------------------------------------------------
G1NHG8_BMF-01          --------------------------------------------------
A0A3B4UNJ0_BMF-01      R-------------------------------------------------
A0A3B4B6Y3_BMF-01      --------------------------------------------------
A0A3P9ICE1_BMF-01      QR------------------------------------------------
Q0GKC7_BMF-01          RR------------------------------------------------
A0A3B3RH63_BMF-01      QR------------------------------------------------
W5N4P7_BMF-01          R-------------------------------------------------
A0A3B1K1X5_BMF-01      RR------------------------------------------------
A0A3B4CNJ8_BMF-01      QR------------------------------------------------
A0A2U9CJH3_BMF-01      RRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLP
A0A3Q2YCX7_BMF-01      --------------------------------------------------
A0A3Q2YCX7_BMF-02      --------------------------------------------------
A0A3P8ZIE7_BMF-01      WR------------------------------------------------
A0A3Q3QZ16_BMF-01      RR------------------------------------------------
A0A3Q3QZ16_BMF-02      RR------------------------------------------------
A0A3Q2PJX9_BMF-02      --------------------------------------------------
A0A3Q2PJX9_BMF-01      RR------------------------------------------------
A0A3Q2PJX9_BMF-03      RR------------------------------------------------
A0A3B5QK08_BMF-01      RR------------------------------------------------
A0A3B5QK08_BMF-02      RR------------------------------------------------
A0A096LRV0_BMF-01      RR------------------------------------------------
A0A3B3WU80_BMF-01      RR------------------------------------------------
A0A3P9Q8E2_BMF-01      RR------------------------------------------------
A0A3Q2CXC4_BMF-01      --------------------------------------------------
A0A3Q2CXC4_BMF-02      --------------------------------------------------
A0A3Q3GUU5_BMF-01      RR------------------------------------------------
A0A3B5B8F6_BMF-01      RR------------------------------------------------
A0A3P8UA78_BMF-02      RR------------------------------------------------
A0A3P8UA78_BMF-01      RR------------------------------------------------
A0A3P8UA78_BMF-03      RR------------------------------------------------
A0A3B3CGR9_BMF-01      QR------------------------------------------------
A0A3P9K487_BMF-02      QRLSVMSD------------------------------------------
A0A3P9K487_BMF-01      QR------------------------------------------------
A0A3B3HAU1_BMF-01      QR------------------------------------------------
A0A3B3HAU1_BMF-03      QR------------------------------------------------
A0A3B3HAU1_BMF-02      QR------------------------------------------------
A0A3B3HAU1_BMF-04      QRQSVVSD------------------------------------------
A0A3P9ICE1_BMF-04      QRLSVLSD------------------------------------------
A0A3Q2ZA20_BMF-01      RR------------------------------------------------
A0A3P8NFE2_BMF-02      LSQWQFLTVN----------------------------------------
I3K2D6_BMF-01          RR------------------------------------------------
A0A3P8NFE2_BMF-01      RR------------------------------------------------
A0A3Q3C5V2_BMF-01      RR------------------------------------------------
A0A3P9DPJ5_BMF-02      RR------------------------------------------------
A0A3P9DPJ5_BMF-01      RR------------------------------------------------
A0A3B4ETH0_BMF-01      RR------------------------------------------------
A0A3Q4G1I4_BMF-01      RR------------------------------------------------
A0A3Q1FVH7_BMF-01      RR------------------------------------------------
A0A3Q1FVH7_BMF-02      RR------------------------------------------------
A0A3Q1D1K3_BMF-01      RR------------------------------------------------
A0A3P8RKY9_BMF-01      RR------------------------------------------------
A0A3Q1IPR4_BMF-01      RR------------------------------------------------
A0A3B4U5H8_BMF-01      RR------------------------------------------------
A0A3B4WM88_BMF-01      RR------------------------------------------------
A0A3Q3RVI2_BMF-01      --------------------------------------------------
A0A3Q3RVI2_BMF-02      RR------------------------------------------------
A0A3Q3VLX6_BMF-01      RR------------------------------------------------
A0A3B5KWG6_BMF-01      RR------------------------------------------------
A9XRH0_BMF-01          --------------------------------------------------
A3KND0_BMF-01          --------------------------------------------------
                                                                         

A0A452H3N6_BMF-01      -----
A0A287AIU8_BMF-02      -----
G1PAU1_BMF-01          -----
A0A287AIU8_BMF-01      -----
A0A1U8CPE0_BMF-02      -----
A0A286XXB0_BMF-03      -----
A0A287CXH0_BMF-02      -----
A0A1S3EQA2_BMF-02      -----
A2AV74_BMF-02          -----
A0A337ST43_BMF-02      -----
A0A2K5KGP2_BMF-01      -----
A0A2K6FFN3_BMF-02      -----
A0A2K5E1Q4_BMF-02      -----
A0A2K5RN49_BMF-02      -----
A0A2K6TW78_BMF-03      -----
A0A2K6RAW1_BMF-02      -----
A0A2I2Z168_BMF-02      -----
A0A2R9BS98_BMF-02      -----
A0A2J8QDD5_BMF-01      -----
A0A2K5MJW4_BMF-01      -----
A0A2K5VLE9_BMF-01      -----
A0A2K6B5F6_BMF-03      -----
A0A2K5Z4A9_BMF-02      -----
A0A096NTE9_BMF-03      -----
A0A2I3HD83_BMF-01      -----
A0A1S3EQA2_BMF-01      -----
Q8K589_BMF-01          -----
A0A337ST43_BMF-04      -----
A0A337ST43_BMF-05      -----
A2AV74_BMF-01          -----
A0A286XXB0_BMF-02      -----
G3WDQ2_BMF-01          -----
G3T7Z4_BMF-01          -----
A0A287CXH0_BMF-01      -----
A0A1S3WU31_BMF-01      -----
A0A1U8CPE0_BMF-01      -----
G1SR62_BMF-01          -----
M3YAD5_BMF-01          -----
U6CSY8_BMF-01          -----
A0A452SED0_BMF-01      -----
A0A384D070_BMF-01      -----
W5QFV1_BMF-01          -----
L8IXF5_BMF-01          -----
A0A452F2E0_BMF-01      -----
A0A452F2E0_BMF-02      -----
Q05KI3_BMF-01          -----
Q05KI3_BMF-02          -----
A0A2K6FFN3_BMF-01      -----
H0WYH6_BMF-01          -----
A0A096NTE9_BMF-01      -----
A0A2K6L919_BMF-02      -----
A0A2K5E1Q4_BMF-01      -----
A0A2K6TW78_BMF-02      -----
A0A2K6TW78_BMF-01      -----
A0A2K5RN49_BMF-01      -----
A0A2I2Z168_BMF-01      -----
A0A2R9BS98_BMF-01      -----
A0A2J8QDD5_BMF-02      -----
A0A2J8T301_BMF-01      -----
F7CM09_BMF-01          -----
A0A2K5MJW4_BMF-02      -----
A0A2K5KGP2_BMF-02      -----
A0A2K5VLE9_BMF-02      -----
F7CM09_BMF-02          -----
F7CM09_BMF-03          -----
A0A2K6B5F6_BMF-01      -----
A0A2K6B5F6_BMF-02      -----
A0A2K6B5F6_BMF-04      -----
A0A2K5Z4A9_BMF-01      -----
A0A2K6L919_BMF-01      -----
A0A2K6L919_BMF-03      -----
A0A2K6RAW1_BMF-01      -----
A0A0D9R4R5_BMF-01      -----
A0A337ST43_BMF-01      -----
A0A337ST43_BMF-03      -----
A0A3Q2HR24_BMF-02      -----
A0A3Q2HR24_BMF-01      -----
J9PB65_BMF-03          -----
J9PB65_BMF-04          -----
J9PB65_BMF-02          -----
J9PB65_BMF-01          -----
A0A493T7X1_BMF-01      -----
H9GL49_BMF-01          -----
A0A3Q2UCA0_BMF-01      -----
A0A3Q2UCA0_BMF-02      -----
K7FRX2_BMF-01          -----
U3JS06_BMF-01          -----
H0ZMX5_BMF-01          -----
A0A493T7X1_BMF-02      -----
A0A3Q2UCA0_BMF-03      -----
A0A3Q2UCA0_BMF-04      -----
G1NHG8_BMF-01          -----
A0A3B4UNJ0_BMF-01      -----
A0A3B4B6Y3_BMF-01      -----
A0A3P9ICE1_BMF-01      -----
Q0GKC7_BMF-01          -----
A0A3B3RH63_BMF-01      -----
W5N4P7_BMF-01          -----
A0A3B1K1X5_BMF-01      -----
A0A3B4CNJ8_BMF-01      -----
A0A2U9CJH3_BMF-01      CALIG
A0A3Q2YCX7_BMF-01      -----
A0A3Q2YCX7_BMF-02      -----
A0A3P8ZIE7_BMF-01      -----
A0A3Q3QZ16_BMF-01      -----
A0A3Q3QZ16_BMF-02      -----
A0A3Q2PJX9_BMF-02      -----
A0A3Q2PJX9_BMF-01      -----
A0A3Q2PJX9_BMF-03      -----
A0A3B5QK08_BMF-01      -----
A0A3B5QK08_BMF-02      -----
A0A096LRV0_BMF-01      -----
A0A3B3WU80_BMF-01      -----
A0A3P9Q8E2_BMF-01      -----
A0A3Q2CXC4_BMF-01      -----
A0A3Q2CXC4_BMF-02      -----
A0A3Q3GUU5_BMF-01      -----
A0A3B5B8F6_BMF-01      -----
A0A3P8UA78_BMF-02      -----
A0A3P8UA78_BMF-01      -----
A0A3P8UA78_BMF-03      -----
A0A3B3CGR9_BMF-01      -----
A0A3P9K487_BMF-02      -----
A0A3P9K487_BMF-01      -----
A0A3B3HAU1_BMF-01      -----
A0A3B3HAU1_BMF-03      -----
A0A3B3HAU1_BMF-02      -----
A0A3B3HAU1_BMF-04      -----
A0A3P9ICE1_BMF-04      -----
A0A3Q2ZA20_BMF-01      -----
A0A3P8NFE2_BMF-02      -----
I3K2D6_BMF-01          -----
A0A3P8NFE2_BMF-01      -----
A0A3Q3C5V2_BMF-01      -----
A0A3P9DPJ5_BMF-02      -----
A0A3P9DPJ5_BMF-01      -----
A0A3B4ETH0_BMF-01      -----
A0A3Q4G1I4_BMF-01      -----
A0A3Q1FVH7_BMF-01      -----
A0A3Q1FVH7_BMF-02      -----
A0A3Q1D1K3_BMF-01      -----
A0A3P8RKY9_BMF-01      -----
A0A3Q1IPR4_BMF-01      -----
A0A3B4U5H8_BMF-01      -----
A0A3B4WM88_BMF-01      -----
A0A3Q3RVI2_BMF-01      -----
A0A3Q3RVI2_BMF-02      -----
A0A3Q3VLX6_BMF-01      -----
A0A3B5KWG6_BMF-01      -----
A9XRH0_BMF-01          -----
A3KND0_BMF-01          -----
                            

© 1998-2019