Dataset for protein Bik of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

31 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6RS78_BIK-02          MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVG
I3LVX0_BIK-01          --------------------------------------------------
F6RS78_BIK-01          ---------------------------------------------MSQVG
W5QCU2_BIK-01          ---------------------------------------------MYQAR
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          ---------------------------------------------MSEAR
O70337_BIK-01          ---------------------------------------------MSEAR
Q925D2_BIK-01          ---------------------------------------------MSEAR
G1TZR9_BIK-01          ---------------------------------------------MSEVR
H0W025_BIK-01          ---------------------------------------------MSEAK
A0A2K5CLG5_BIK-01      ---------------------------------------------MSEVR
F7FUT7_BIK-01          ---------------------------------------------MSEVR
A0A2K6TBD7_BIK-01      ---------------------------------------------MSEDR
H2P4N6_BIK-01          ---------------------------------------------MSEVR
G1S1X2_BIK-01          ---------------------------------------------MSEVR
G3QCT2_BIK-01          ---------------------------------------------MSEVR
A0A2R8ZXD2_BIK-01      ---------------------------------------------MSEVR
H2QLU7_BIK-01          ---------------------------------------------MSEVR
Q13323_BIK-01          ---------------------------------------------MSEVR
A0A2K6MCW0_BIK-01      ---------------------------------------------MSGVR
A0A2K6QK74_BIK-01      ---------------------------------------------MSGVR
A0A0D9QZY8_BIK-01      ---------------------------------------------MSGVR
A0A2K5VW94_BIK-01      ---------------------------------------------MSGVR
A0A2K6DBJ4_BIK-01      ---------------------------------------------MSGVR
A0A2K5J4Q7_BIK-01      ---------------------------------------------MSGVR
A0A096NKG5_BIK-01      ---------------------------------------------MSGVR
A0A2K5LDM6_BIK-01      ---------------------------------------------MSGVR
A0A2K5XSA1_BIK-01      ---------------------------------------------MSGVR
F1PUF4_BIK-01          ---------------------------------------------MSHSG
H0XAE7_BIK-01          ---------------------------------------------MSAGR
A0A2K6FM79_BIK-01      ---------------------------------------------MSEVR
                                                                         

F6RS78_BIK-02          PVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSD--------------
I3LVX0_BIK-01          -----------------------------------------------MVQ
F6RS78_BIK-01          PVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSD--------------
W5QCU2_BIK-01          PLSRNLFLYTFLQNHGPGFLDDQ-GSGLPGVTSILEFHPISPYS-----D
O70337_BIK-04          ------------------------------------------------MF
O70337_BIK-02          LMARDV-IKTVPHDQVPQPPVASETPSMKE--------PVRDVDLMECVE
O70337_BIK-01          LMARDV-IKTVPHDQVPQPPVASETPSMKE--------PVRDVDLMECVE
Q925D2_BIK-01          LMARDI-IKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLE
G1TZR9_BIK-01          PGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLD------LMECLE
H0W025_BIK-01          PVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDLSPPGDTNLMECVE
A0A2K5CLG5_BIK-01      PLSSDILMETLLCEQFVHPLTME-VVGGSDP--EEDLDPVED--PLECME
F7FUT7_BIK-01          PLSSDIFMETLLCEQFVDPLTME-VVGGSDP--EEDLDPVED--PLECME
A0A2K6TBD7_BIK-01      PLSSDILMETLLCEQFVDPLTME-VVGGSDP--EEDPDSVED--PLECME
H2P4N6_BIK-01          PISRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFSPLECME
G1S1X2_BIK-01          PISRDILMESLLYEQLLEPPTME-VLGVTDP--EEDLDPMEDFDPLQCME
G3QCT2_BIK-01          PLSRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFDSLECME
A0A2R8ZXD2_BIK-01      PLSRDILMETLLYEQLLEPPTME-VLGVTES--EEDLDPMEDFDSLECME
H2QLU7_BIK-01          PLSRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFDSLECME
Q13323_BIK-01          PLSRDILMETLLYEQLLEPPTME-VLGMTDS--EEDLDPMEDFDSLECME
A0A2K6MCW0_BIK-01      PVSRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A2K6QK74_BIK-01      PVSRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A0D9QZY8_BIK-01      PISRHILMESLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A2K5VW94_BIK-01      PISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFNPLECME
A0A2K6DBJ4_BIK-01      PISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECIE
A0A2K5J4Q7_BIK-01      PISRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A096NKG5_BIK-01      PISRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A2K5LDM6_BIK-01      PISRDTWMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
A0A2K5XSA1_BIK-01      PISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDPLECME
F1PUF4_BIK-01          PLSRNLFLSTFLQEH--GPEVLE-VPGMTDL--VEYYDP----GPSPNSN
H0XAE7_BIK-01          PVSMDHFMETFPFEQLLEPLTME-VLGMTE--------P----NPMECLE
A0A2K6FM79_BIK-01      PVSTDLLMETFPFEHLLDPLILE-VLSIMDN--EE--NP----DPSGCLE
                                                                         

F6RS78_BIK-02          NRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTY---NQTGLRG
I3LVX0_BIK-01          GSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSY---SQARVTG
F6RS78_BIK-01          NRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTY---NQTGLRG
W5QCU2_BIK-01          SPHYLAMQLASIADEMELRLLLPQFVEPFWMPMYSLCFPY---SHVGLRD
O70337_BIK-04          TRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SRTGVRG
O70337_BIK-02          GRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SRTGVRG
O70337_BIK-01          GRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SRTGVRG
Q925D2_BIK-01          SRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAATY---SQTGVRG
G1TZR9_BIK-01          GSNQVALRLAYIGDEMDLHVRGLHTGPAAGVAMHS--LAFTYSQT-GFTG
H0W025_BIK-01          GSSLVALRLACIGDEMDLRLRSPRLAQLPGRAVHSLAITY---SQMGLWG
A0A2K5CLG5_BIK-01      NSDALVLQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFILDRT-DIGD
F7FUT7_BIK-01          NSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRT-DIGD
A0A2K6TBD7_BIK-01      NSDALALQLACIADQMDVSLRARRLAQLYEVATYSPGLAFILDRT-DIRD
H2P4N6_BIK-01          GSDALALRLACIGDEMDVSLRAPRRAQLPEVAMHSLGLAFIYDQTEDIRD
G1S1X2_BIK-01          GSDALAPRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD
G3QCT2_BIK-01          GSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD
A0A2R8ZXD2_BIK-01      GSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRD
H2QLU7_BIK-01          GSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRD
Q13323_BIK-01          GSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRD
A0A2K6MCW0_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A2K6QK74_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A0D9QZY8_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A2K5VW94_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRD
A0A2K6DBJ4_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRD
A0A2K5J4Q7_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A096NKG5_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A2K5LDM6_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFICDQTDDIRD
A0A2K5XSA1_BIK-01      DSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
F1PUF4_BIK-01          NPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLA--FTYNQT-GLRG
H0XAE7_BIK-01          DSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLG--LSYNQT-DGQG
A0A2K6FM79_BIK-01      DSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMHSLGLALSCDQP-VRWG
                           :. .** *.*:*:      .       . :               .

F6RS78_BIK-02          VFRSFMDGLTNLRENI-RFWSF--LTRRDRVSLRFHDLDSPSCMCSPLEP
I3LVX0_BIK-01          VLRSLAQGLASLRENMW-FWRP--AAPSTRVP------------------
F6RS78_BIK-01          VFRSFMDGLTNLRENI-RFWSF--LTRRDRVSLRFHDLDSPSCMCSPLEP
W5QCU2_BIK-01          VLRSFMVAFTNLRENR-RLWSF--LTLRDRVS------------------
O70337_BIK-04          IFRSLIRSLTNLRENIWS-WRV--LTPGAWVS------------------
O70337_BIK-02          IFRSLIRSLTNLRENIWS-WRV--LTPGAWVS------------------
O70337_BIK-01          IFRSLIRSLTNLRENIWS-WRV--LTPGAWVS------------------
Q925D2_BIK-01          IFRSLIGSLTNLRENIWS-WRV--FTPGAWVS------------------
G1TZR9_BIK-01          VLGSVGLHLASLVE----LWSPWGRGAAAPAA------------------
H0W025_BIK-01          VLGRLTLSLASLRDNV---WACGRPASRAWVS------------------
A0A2K5CLG5_BIK-01      VLSGIVEVFANFQEDIVRLWRS--LSSGSWVS------------------
F7FUT7_BIK-01          VLSGVVDVFANFQEDIVRLWRS--LSSGSWVS------------------
A0A2K6TBD7_BIK-01      VLSGVVDVFADFQEDIVRLWRS--LSSGSWVS------------------
H2P4N6_BIK-01          VLRSFTDGFTTLKENIMRFWSS--L-------------------------
G1S1X2_BIK-01          VLRSFMDGFTTFKENIIRLWRS--PNPGSRVS------------------
G3QCT2_BIK-01          VLRSFMDGFTTLKENIMRFWRS--PNPGSWVS------------------
A0A2R8ZXD2_BIK-01      VLRSFMDGFTTLKENIMRFWRS--PNPRSWVS------------------
H2QLU7_BIK-01          VLRSFMDGFTTLKENIMRFWRS--PNPGSWVS------------------
Q13323_BIK-01          VLRSFMDGFTTLKENIMRFWRS--PNPGSWVS------------------
A0A2K6MCW0_BIK-01      VLTSFMDGFTTLKENIMRFWRS--LNPGSQVS------------------
A0A2K6QK74_BIK-01      VLTSFMDGFTTLKENIMRFWRS--LNPGSQVS------------------
A0A0D9QZY8_BIK-01      VLRSFIDGFTTLRENIMRFWRS--LNPGSWVS------------------
A0A2K5VW94_BIK-01      VLRSFMDGFTTLRENIMRFWRS--PNPRSWVS------------------
A0A2K6DBJ4_BIK-01      VLRSFMDGFTTLRENIMRFWRS--PNPRSWVS------------------
A0A2K5J4Q7_BIK-01      VLRSFMDGFTTLKENIMRFWRS--PNPGSRVS------------------
A0A096NKG5_BIK-01      VLRSFMDGFTTLRENIMRFWRS--PNPRSWVS------------------
A0A2K5LDM6_BIK-01      VLRSFMDGFTTLRENIMRFWRS--PNPRSWVS------------------
A0A2K5XSA1_BIK-01      VLRSFLDGFTTLRENIMRFWRS--PNPRSWVS------------------
F1PUF4_BIK-01          VLRSFLDGLANLRENI-RIWSF--LTFRNRVS------------------
H0XAE7_BIK-01          VLRSVISGFTNLRENIAGFWRS--LSRGPWVC------------------
A0A2K6FM79_BIK-01      VLGSLSDGFANLREYVARLWRS--LSPRPWVC------------------
                       ::  .   :: : :     *                              

F6RS78_BIK-02          WSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
I3LVX0_BIK-01          ----------------PARACRELLPVLLLLGLLLSR--ALYLRLQ
F6RS78_BIK-01          WSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
W5QCU2_BIK-01          ----------------PS--LWPELALSLLVVAMLSW--GCRF---
O70337_BIK-04          ----------------PDQDPGQLFPMVLLVFLLLGG--AWYLQLQ
O70337_BIK-02          ----------------PDQDPGQLFPMVLLVFLLLGG--AWYLQLQ
O70337_BIK-01          ----------------PDQDPGQLFPMVLLVFLLLGG--AWYLQLQ
Q925D2_BIK-01          ----------------PDQDPGQLFPMVLLVFLLLGG--AWHLQLQ
G1TZR9_BIK-01          ----------------VRPLPGQGWPPSWRVVLLGAG--SWGLRMP
H0W025_BIK-01          ----------------PRWTCRWLLPVLLLLLLLL-G--TLRLLLQ
A0A2K5CLG5_BIK-01      ----------------RKQAVL--LALLALLLAMFSG--GLHLLLK
F7FUT7_BIK-01          ----------------RKQAVL--LALLALLLAMFSG--GLHLLLK
A0A2K6TBD7_BIK-01      ----------------GKQAVL--LALLALLLAMFSG--GLRLLLK
H2P4N6_BIK-01          ----------------------------------------------
G1S1X2_BIK-01          ----------------REQMLLVLLVLLLLLLPLLSG--GLYLLN-
G3QCT2_BIK-01          ----------------REQVLLALLLLLALLLPLLSG--GLHLLLK
A0A2R8ZXD2_BIK-01      ----------------REQVLLALLLLLALLLPLLSG--GLHLLLK
H2QLU7_BIK-01          ----------------REQVLLALLLLLALLLPLLSG--GLHLLLK
Q13323_BIK-01          ----------------CEQVLLALLLLLALLLPLLSG--GLHLLLK
A0A2K6MCW0_BIK-01      ----------------REQVLLALLLLLA---ALLSG--GLHLLLK
A0A2K6QK74_BIK-01      ----------------REQVLLALLLLLA---ALLSG--GLHLLLK
A0A0D9QZY8_BIK-01      ----------------REQVLLALL-LLALLLALLSG--GLHLLLK
A0A2K5VW94_BIK-01      ----------------REQVLLVLLLLLALLLALLSG--GLHLLLK
A0A2K6DBJ4_BIK-01      ----------------REQVLLVLLLLLALLLALLSG--GLHLLLK
A0A2K5J4Q7_BIK-01      ----------------REQVLLALLLLLALLLALLSG--GLHLLLK
A0A096NKG5_BIK-01      ----------------REQVLLALLLLLALLLALLSG--GLHLLLK
A0A2K5LDM6_BIK-01      ----------------HEQVLL----LLALLLALLSG--GLHLLLK
A0A2K5XSA1_BIK-01      ----------------REQVLL----LLALLLALLSG--GLHLLLK
F1PUF4_BIK-01          ----------------PNPGRGLVLSLLLLLVLLLGW--GLRLLQ-
H0XAE7_BIK-01          ----------------PAPAWEQVLLLLLLLVLLLAG--GLHLLLK
A0A2K6FM79_BIK-01      ----------------PAPAWEQVLLLLLVL-LLLGG--GLHLLLK
                                                                     

© 1998-2019