Dataset for protein Bik of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

31 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6RS78_BIK-01          MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDS---------QSPSP
I3LVX0_BIK-01          --------------------------------------------------
W5QCU2_BIK-01          MYQARPLSRNLFLYTFLQNHGPGFLDDQ-GSGLPGVTSILEFHPISPYS-
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          MSEARLMARDV-IKTVPHDQVPQPPVASETPSMKE--------PVRDVDL
O70337_BIK-01          MSEARLMARDV-IKTVPHDQVPQPPVASETPSMKE--------PVRDVDL
Q925D2_BIK-01          MSEARLMARDI-IKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDF
G1TZR9_BIK-01          MSEVRPGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLDLM-----
F1PUF4_BIK-01          MSHSGPLSRNLFLSTFLQEH--GPEVLE-VPGMTDL--VEYYDP----GP
H0XAE7_BIK-01          MSAGRPVSMDHFMETFPFEQLLEPLTME-VLGMTE--------P----NP
A0A2K6FM79_BIK-01      MSEVRPVSTDLLMETFPFEHLLDPLILE-VLSIMDN--EE--NP----DP
A0A1S3FUQ7_BIK-01      MSEAGSVTRDLFIKTLLYQQMPGPRPAAGLFPITEPMGEEVWDPM-----
H0W025_BIK-01          MSEAKPVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDLSPPGDTNL
A0A2K5CLG5_BIK-01      MSEVRPLSSDILMETLLCEQFVHPLTME-VVGGSDP--EEDLDPVED--P
F7FUT7_BIK-01          MSEVRPLSSDIFMETLLCEQFVDPLTME-VVGGSDP--EEDLDPVED--P
A0A2K6TBD7_BIK-01      MSEDRPLSSDILMETLLCEQFVDPLTME-VVGGSDP--EEDPDSVED--P
H2P4N6_BIK-01          MSEVRPISRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFSP
G1S1X2_BIK-01          MSEVRPISRDILMESLLYEQLLEPPTME-VLGVTDP--EEDLDPMEDFDP
G3QCT2_BIK-01          MSEVRPLSRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFDS
A0A2R8ZXD2_BIK-01      MSEVRPLSRDILMETLLYEQLLEPPTME-VLGVTES--EEDLDPMEDFDS
H2QLU7_BIK-01          MSEVRPLSRDILMETLLYEQLLEPPTME-VLGVTDS--EEDLDPMEDFDS
Q13323_BIK-01          MSEVRPLSRDILMETLLYEQLLEPPTME-VLGMTDS--EEDLDPMEDFDS
A0A2K6MCW0_BIK-01      MSGVRPVSRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A2K6QK74_BIK-01      MSGVRPVSRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A0D9QZY8_BIK-01      MSGVRPISRHILMESLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A2K5VW94_BIK-01      MSGVRPISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFNP
A0A2K6DBJ4_BIK-01      MSGVRPISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A2K5J4Q7_BIK-01      MSGVRPISRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A096NKG5_BIK-01      MSGVRPISRDILMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A2K5LDM6_BIK-01      MSGVRPISRDTWMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
A0A2K5XSA1_BIK-01      MSGVRPISRDTLMETLLYEQLLEPLTME-VLGVTDP--EEDLDPMEDFDP
                                                                         

F6RS78_BIK-01          QGEGDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVY-----------
I3LVX0_BIK-01          --MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSY---SQ
W5QCU2_BIK-01          ----DSPHYLAMQLASIADEMELRLLLPQFVEPFWMPMYSLCFPY---SH
O70337_BIK-04          ---MFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SR
O70337_BIK-02          MECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SR
O70337_BIK-01          MECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTY---SR
Q925D2_BIK-01          MRCLESRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAATY---SQ
G1TZR9_BIK-01          -ECLEGSNQVALRLAYIGDEMDLHVRGLHTGPAAGVAMHSLAFTY---SQ
F1PUF4_BIK-01          SPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLA--FTYNQT
H0XAE7_BIK-01          MECLEDSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLG--LSYNQT
A0A2K6FM79_BIK-01      SGCLEDSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMHSLGLALSCDQP
A0A1S3FUQ7_BIK-01      -DCLEGSNQVALWLVCIGDEMDQRLRSPRLAQLPGMAIHSLALTY---SQ
H0W025_BIK-01          MECVEGSSLVALRLACIGDEMDLRLRSPRLAQLPGRAVHSLAITY---SQ
A0A2K5CLG5_BIK-01      LECMENSDALVLQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFILDRT
F7FUT7_BIK-01          LECMENSDALALQLACIADQMDVSLRARRLAQLYEVAMYSPGLAFVLDRT
A0A2K6TBD7_BIK-01      LECMENSDALALQLACIADQMDVSLRARRLAQLYEVATYSPGLAFILDRT
H2P4N6_BIK-01          LECMEGSDALALRLACIGDEMDVSLRAPRRAQLPEVAMHSLGLAFIYDQT
G1S1X2_BIK-01          LQCMEGSDALAPRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
G3QCT2_BIK-01          LECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A2R8ZXD2_BIK-01      LECMEGSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQT
H2QLU7_BIK-01          LECMEGSDALALRLACIGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQT
Q13323_BIK-01          LECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A2K6MCW0_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A2K6QK74_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A0D9QZY8_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A2K5VW94_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQM
A0A2K6DBJ4_BIK-01      LECIEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQM
A0A2K5J4Q7_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A096NKG5_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
A0A2K5LDM6_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFICDQT
A0A2K5XSA1_BIK-01      LECMEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQT
                                :. .*. *.*:*:      .       . :           

F6RS78_BIK-01          --------------------------------------------------
I3LVX0_BIK-01          ARVTGVLRSLAQGLASLRENMW-FWRP--AAPSTRVPPARACRELLPVLL
W5QCU2_BIK-01          VGLRDVLRSFMVAFTNLRENR-RLWSF--LTLRDRVSPS--LWPELALSL
O70337_BIK-04          TGVRGIFRSLIRSLTNLRENIWS-WRV--LTPGAWVSPDQDPGQLFPMVL
O70337_BIK-02          TGVRGIFRSLIRSLTNLRENIWS-WRV--LTPGAWVSPDQDPGQLFPMVL
O70337_BIK-01          TGVRGIFRSLIRSLTNLRENIWS-WRV--LTPGAWVSPDQDPGQLFPMVL
Q925D2_BIK-01          TGVRGIFRSLIGSLTNLRENIWS-WRV--FTPGAWVSPDQDPGQLFPMVL
G1TZR9_BIK-01          TGFTGVLGSVGLHLASLVE----LWSPWGRGAAAPAAVRPLPGQGWPPSW
F1PUF4_BIK-01          -GLRGVLRSFLDGLANLRENI-RIWSF--LTFRNRVSPNPGRGLVLSLLL
H0XAE7_BIK-01          -DGQGVLRSVISGFTNLRENIAGFWRS--LSRGPWVCPAPAWEQVLLLLL
A0A2K6FM79_BIK-01      -VRWGVLGSLSDGFANLREYVARLWRS--LSPRPWVCPAPAWEQVLLLLL
A0A1S3FUQ7_BIK-01      MGVWGVLRRLIRGVAHLRAHI-RAWRP--PIPRLQVSPGQVRRQMLPAVL
H0W025_BIK-01          MGLWGVLGRLTLSLASLRDNV---WACGRPASRAWVSPRWTCRWLLPVLL
A0A2K5CLG5_BIK-01      -DIGDVLSGIVEVFANFQEDIVRLWRS--LSSGSWVSRKQAVL--LALLA
F7FUT7_BIK-01          -DIGDVLSGVVDVFANFQEDIVRLWRS--LSSGSWVSRKQAVL--LALLA
A0A2K6TBD7_BIK-01      -DIRDVLSGVVDVFADFQEDIVRLWRS--LSSGSWVSGKQAVL--LALLA
H2P4N6_BIK-01          EDIRDVLRSFTDGFTTLKENIMRFWSS--L--------------------
G1S1X2_BIK-01          EDIRDVLRSFMDGFTTFKENIIRLWRS--PNPGSRVSREQMLLVLLVLLL
G3QCT2_BIK-01          EDIRDVLRSFMDGFTTLKENIMRFWRS--PNPGSWVSREQVLLALLLLLA
A0A2R8ZXD2_BIK-01      EDIRDVLRSFMDGFTTLKENIMRFWRS--PNPRSWVSREQVLLALLLLLA
H2QLU7_BIK-01          EDIRDVLRSFMDGFTTLKENIMRFWRS--PNPGSWVSREQVLLALLLLLA
Q13323_BIK-01          EDIRDVLRSFMDGFTTLKENIMRFWRS--PNPGSWVSCEQVLLALLLLLA
A0A2K6MCW0_BIK-01      DDIRDVLTSFMDGFTTLKENIMRFWRS--LNPGSQVSREQVLLALLLLLA
A0A2K6QK74_BIK-01      DDIRDVLTSFMDGFTTLKENIMRFWRS--LNPGSQVSREQVLLALLLLLA
A0A0D9QZY8_BIK-01      DDIRDVLRSFIDGFTTLRENIMRFWRS--LNPGSWVSREQVLLALL-LLA
A0A2K5VW94_BIK-01      DDIRDVLRSFMDGFTTLRENIMRFWRS--PNPRSWVSREQVLLVLLLLLA
A0A2K6DBJ4_BIK-01      DDIRDVLRSFMDGFTTLRENIMRFWRS--PNPRSWVSREQVLLVLLLLLA
A0A2K5J4Q7_BIK-01      DDIRDVLRSFMDGFTTLKENIMRFWRS--PNPGSRVSREQVLLALLLLLA
A0A096NKG5_BIK-01      DDIRDVLRSFMDGFTTLRENIMRFWRS--PNPRSWVSREQVLLALLLLLA
A0A2K5LDM6_BIK-01      DDIRDVLRSFMDGFTTLRENIMRFWRS--PNPRSWVSHEQVLL----LLA
A0A2K5XSA1_BIK-01      DDIRDVLRSFLDGFTTLRENIMRFWRS--PNPRSWVSREQVLL----LLA
                                                                         

F6RS78_BIK-01          ---------------
I3LVX0_BIK-01          LLGLLLSRALYLRLQ
W5QCU2_BIK-01          LVVAMLSWGCRF---
O70337_BIK-04          LVFLLLGGAWYLQLQ
O70337_BIK-02          LVFLLLGGAWYLQLQ
O70337_BIK-01          LVFLLLGGAWYLQLQ
Q925D2_BIK-01          LVFLLLGGAWHLQLQ
G1TZR9_BIK-01          RVVLLGAGSWGLRMP
F1PUF4_BIK-01          LLVLLLGWGLRLLQ-
H0XAE7_BIK-01          LLVLLLAGGLHLLLK
A0A2K6FM79_BIK-01      VL-LLLGGGLHLLLK
A0A1S3FUQ7_BIK-01      ----LLCGALQLLLQ
H0W025_BIK-01          LLLLLL-GTLRLLLQ
A0A2K5CLG5_BIK-01      LLLAMFSGGLHLLLK
F7FUT7_BIK-01          LLLAMFSGGLHLLLK
A0A2K6TBD7_BIK-01      LLLAMFSGGLRLLLK
H2P4N6_BIK-01          ---------------
G1S1X2_BIK-01          LLLPLLSGGLYLLN-
G3QCT2_BIK-01          LLLPLLSGGLHLLLK
A0A2R8ZXD2_BIK-01      LLLPLLSGGLHLLLK
H2QLU7_BIK-01          LLLPLLSGGLHLLLK
Q13323_BIK-01          LLLPLLSGGLHLLLK
A0A2K6MCW0_BIK-01      ---ALLSGGLHLLLK
A0A2K6QK74_BIK-01      ---ALLSGGLHLLLK
A0A0D9QZY8_BIK-01      LLLALLSGGLHLLLK
A0A2K5VW94_BIK-01      LLLALLSGGLHLLLK
A0A2K6DBJ4_BIK-01      LLLALLSGGLHLLLK
A0A2K5J4Q7_BIK-01      LLLALLSGGLHLLLK
A0A096NKG5_BIK-01      LLLALLSGGLHLLLK
A0A2K5LDM6_BIK-01      LLLALLSGGLHLLLK
A0A2K5XSA1_BIK-01      LLLALLSGGLHLLLK
                                      

© 1998-2018