Dataset for protein Bim of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

235 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
K7GA86_BCL2L11-01       ------------MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFP
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLC
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
F7A7D2_BCL2L11-01       --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A1S3FHA8_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------MPTEESLQFDKDQGTSDV
R4G9R5_BCL2L11-01       ------------------------------------------MLVVGSSQ
B2KKY9_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
B8JK68_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
K7GA86_BCL2L11-01       APAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDL
G3SU55_BCL2L11-01       ------------------------------------------MAKQPSDV
G3W979_BCL2L11-01       ------------------------------------------MAKQPSDL
O43521_BCL2L11-11       ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-03       ------------------------------------------MAKQPSDV
O43521_BCL2L11-19       ------------------------------------------MAKQPSDV
O43521_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-23       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
C1KGB8_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-10       ------------------------------------------MAKQPSDV
O43521_BCL2L11-20       ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-17       ------------------------------------------MAKQPSDV
O43521_BCL2L11-13       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-06       ------------------------------------------MAKQPSDV
O43521_BCL2L11-15       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A0D9RWE0_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-05       ------------------------------------------MAKQPSDV
O43521_BCL2L11-25       ------------------------------------------MAKQPSDV
O54918_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-05       ------------------------------------------MAKQPSDV
O88498_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
H2P5E2_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A1S3FHA8_BCL2L11      ------------------------------------------MAKQPSDV
Q4KMV9_BCL2L11-01       ------------------------------------------MAKQPSVL
F7FTC8_BCL2L11-01       ------------------------------------------MAKQPSDL
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
M3YDI3_BCL2L11-01       LPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSDV
F6XMC1_BCL2L11-02       ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-01       ------------------------------------------MAKQPSDV
F7CXT2_BCL2L11-01       ------------------------------------------MAKQPSDL
F6XMC1_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-08       ------------------------------------------MAKQPSDV
O43521_BCL2L11-22       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-21       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-24       ------------------------------------------MAKQPSDV
O43521_BCL2L11-12       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
O54918_BCL2L11-01       ------------------------------------------MAKQPSDV
O88498_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A1U8BW10_BCL2L11      ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-16       ------------------------------------------MAKQPSDV
O43521_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-18       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
W5PY58_BCL2L11-01       ------------------------------------------MAKQPSDV
F7A7D2_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
G1SSY0_BCL2L11-01       ------------------------------------------MAKQPSDV
H0XW23_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A1S3FHA8_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
G1LDR8_BCL2L11-01       ------------------------------------------MAKQPSDV
J9NWV6_BCL2L11-01       ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-01       ------------------------------------------MAKQPSDV
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------MRQAEPADM---------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       ISECGH-----LHPTQRPDQPPFVKQEGCYCIISPLS--KVIALVRWRDR
R4G9R5_BCL2L11-01       PQLCLL--------------PKQLNVLSANAFA-----------------
B2KKY9_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPGEGDPLR-------------GGIS
B8JK68_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPGEGDPLR-------------GGIS
K7GA86_BCL2L11-01       NSECDG-EGGQFQSIERPSQPQHLRPGAPTSIQTQYQ-------------
G3SU55_BCL2L11-01       SSECDR-EGGQLQPAERPPQPPQLRPGAPTSLLTEPQGNPD----GEGDS
G3W979_BCL2L11-01       NSECDR-EGGQLQPTERPTQ-PQLRPGAPTSIQTQYQGN-S----GEGDS
O43521_BCL2L11-11       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F7HHA9_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQ-------------
O54918_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-19       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-23       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F7HHA9_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
C1KGB8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQ-------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQ-------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQ-------------
O43521_BCL2L11-10       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-20       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-17       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-13       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F7HHA9_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F6XMC1_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F7HHA9_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-15       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F1SU81_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQ-------------
A0A0D9RWE0_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-25       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O54918_BCL2L11-08       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O54918_BCL2L11-06       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQ-------------
Q2YDF0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQ-------------
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O54918_BCL2L11-05       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O88498_BCL2L11-02       NSECDR-EGGQLQPAER---PPQLRPGAPTSLQTESQ-------------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
O43521_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
H2P5E2_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQ-------------
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAGAPTSLQTEPQ-------------
A0A1S3FHA8_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQ-------------
Q4KMV9_BCL2L11-01       SPDCNSGEGGQLQSTSRQHSHRPLRRGAPTSLSSPFQGN----QSDEGGS
F7FTC8_BCL2L11-01       NSECDS-EGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ-------------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTD---------------
M3YDI3_BCL2L11-01       SSECDR-EGGQLQPVER---PPQLRPGAPTSLQTEQQ-------------
F6XMC1_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQ-------------
F6XMC1_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7CXT2_BCL2L11-01       NSECDR-EGGQLQPTERPTQPQQLRPGAPTSIQTQYQGN-----SGEGDS
F6XMC1_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGNPE----GEGDR
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGNPE----GEGDR
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQGNPEGSREGEGDR
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQGNPEGSREGEGDR
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-22       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7HHA9_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F6XMC1_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F6XMC1_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-21       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7HHA9_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-24       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-12       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7HHA9_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O54918_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQGNPD----GEGDR
O88498_BCL2L11-01       NSECDR-EGGQLQPAER---PPQLRPGAPTSLQTESQGNPD----GEGDR
A0A1U8BW10_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGNPD----GEGDR
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEPQGNPE----GEGDR
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQGNPEGSREGEGDR
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPGAPTSLQTEPQGNPEGSREGEGDR
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F6XMC1_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F6XMC1_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7HHA9_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-16       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F7HHA9_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-18       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F6XMC1_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEDNHGGEGDS
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
O43521_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPGAPTSLQTEPQGNPEGNHGGEGDS
F1SU81_BCL2L11-02       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQGN----PEGEGDR
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGN----PEGEGDR
W5PY58_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQGN----PEGEGDR
F7A7D2_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQIEQQGN----PGGEGDR
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAGAPTSLQTEPQGN----PEGAGDR
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAGAPTSLQTEPQGN----PEGAGDR
G1SSY0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQSEPQGN------PEGDR
H0XW23_BCL2L11-01       GSECDR-EGGQLQPAER---PPQLRPGAPTSLHTEPQGNPEGNPEVEGDR
A0A1S3FHA8_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGNPEGSPEGEGDR
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGN----PEGEGDR
G1LDR8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGN----PEGEGDR
J9NWV6_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTEQQGN----PEGEGDR
F1SU81_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPGAPTSLQTERQGN----PEGEGDR
                                                                          

U3IW89_BCL2L11-01       -------------------------------------SSSGYFSFEAE--
Q6JTU4_BCL2L11-01       -------------------------------------RPEIWIAQELR--
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       SLLSTLMGGLLLPPSPCPFVTRSPFFIFMRRSLVLSTSSSGYFTFDSDIV
R4G9R5_BCL2L11-01       --------------------------------------------------
B2KKY9_BCL2L11-01       MSNNQSRSPM---------------------NRTFSRSSSGYFSVDSD--
B8JK68_BCL2L11-01       MSNNQSRSPM---------------------NRTFSRSSSGYFSVDSD--
K7GA86_BCL2L11-01       -----------------------------------------------D--
G3SU55_BCL2L11-01       CPQGSPQGPQAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
G3W979_BCL2L11-01       CSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGYFSFDTD--
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      -----------------------------------------------D--
O54918_BCL2L11-03       -----------------------------------------------D--
O43521_BCL2L11-19       -----------------------------------------------D--
O43521_BCL2L11-07       -----------------------------------------------D--
A0A2I3HW02_BCL2L11      -----------------------------------------------D--
A0A2K6TRZ5_BCL2L11      -----------------------------------------------D--
A0A2K5HZI7_BCL2L11      -----------------------------------------------D--
A0A2K5NU92_BCL2L11      -----------------------------------------------D--
A0A2K5Z8B6_BCL2L11      -----------------------------------------------D--
A0A2I2YQ13_BCL2L11      -----------------------------------------------D--
O43521_BCL2L11-23       -----------------------------------------------D--
A0A2R9CA99_BCL2L11      -----------------------------------------------D--
A0A2J8JCT2_BCL2L11      -----------------------------------------------D--
F7HHA9_BCL2L11-07       -----------------------------------------------D--
A0A2K5CAB2_BCL2L11      -----------------------------------------------D--
A0A2K5X2I7_BCL2L11      -----------------------------------------------D--
A0A2I3M6I1_BCL2L11      -----------------------------------------------D--
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      -----------------------------------------------D--
A0A2K5Z8B6_BCL2L11      -----------------------------------------------D--
A0A2K6KJP8_BCL2L11      -----------------------------------------------D--
A0A2K6QIL2_BCL2L11      -----------------------------------------------D--
F6XMC1_BCL2L11-09       -----------------------------------------------D--
A0A2K6TRZ5_BCL2L11      -----------------------------------------------D--
A0A2K5HZI7_BCL2L11      -----------------------------------------------D--
A0A2R9CA99_BCL2L11      -----------------------------------------------D--
A0A2J8JCT2_BCL2L11      -----------------------------------------------D--
A0A2K5NU92_BCL2L11      -----------------------------------------------D--
A0A2K5X2I7_BCL2L11      -----------------------------------------------D--
F7HHA9_BCL2L11-09       -----------------------------------------------D--
A0A2K6E226_BCL2L11      -----------------------------------------------D--
A0A2I3M6I1_BCL2L11      -----------------------------------------------D--
A0A2I2YQ13_BCL2L11      -----------------------------------------------D--
O43521_BCL2L11-06       -----------------------------------------------D--
O43521_BCL2L11-15       -----------------------------------------------D--
A0A2I3HW02_BCL2L11      -----------------------------------------------D--
F1SU81_BCL2L11-03       -----------------------------------------------D--
A0A0D9RWE0_BCL2L11      -----------------------------------------------D--
O43521_BCL2L11-05       -----------------------------------------------D--
O43521_BCL2L11-25       -----------------------------------------------D--
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
A0A1U8BW10_BCL2L11      -----------------------------------------------D--
Q2YDF0_BCL2L11-01       -----------------------------------------------D--
A0A287DFJ0_BCL2L11      -----------------------------------------------D--
O54918_BCL2L11-05       -----------------------------------------------D--
O88498_BCL2L11-02       -----------------------------------------------D--
A0A2K6GE31_BCL2L11      -----------------------------------------------D--
A0A2K5CAB2_BCL2L11      -----------------------------------------------D--
A0A2K6TRZ5_BCL2L11      -----------------------------------------------D--
A0A2K6QIL2_BCL2L11      -----------------------------------------------D--
A0A2K5NU92_BCL2L11      -----------------------------------------------D--
A0A2K5HZI7_BCL2L11      -----------------------------------------------D--
A0A2K5X2I7_BCL2L11      -----------------------------------------------D--
A0A2K6E226_BCL2L11      -----------------------------------------------D--
A0A2K5Z8B6_BCL2L11      -----------------------------------------------D--
A0A2I3M6I1_BCL2L11      -----------------------------------------------D--
A0A2I3M6I1_BCL2L11      -----------------------------------------------D--
A0A2K6KJP8_BCL2L11      -----------------------------------------------D--
A0A2I2YQ13_BCL2L11      -----------------------------------------------D--
O43521_BCL2L11-02       -----------------------------------------------D--
A0A2R9CA99_BCL2L11      -----------------------------------------------D--
A0A2J8JCT2_BCL2L11      -----------------------------------------------D--
H2P5E2_BCL2L11-01       -----------------------------------------------D--
A0A337SW42_BCL2L11      -----------------------------------------------D--
A0A286XJN2_BCL2L11      -----------------------------------------------D--
A0A1S3FHA8_BCL2L11      -----------------------------------------------D--
Q4KMV9_BCL2L11-01       SSASTPWGPTISPYSPSSFVNRSPHCMLVRGSSLVSKTSSGYFSFEV---
F7FTC8_BCL2L11-01       -----------------------------------------------D--
A0A2K6E226_BCL2L11      ---------------PGPFATRSP--------------------------
M3YDI3_BCL2L11-01       -----------------------------------------------D--
F6XMC1_BCL2L11-02       -----------------------------------------------D--
F6XMC1_BCL2L11-01       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F7CXT2_BCL2L11-01       CSPSSPQGPFAPPTSPSPFATRSPLFIFLRRSPLLPRSSSGYFSFDTD--
F6XMC1_BCL2L11-08       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A337SW42_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTD--
A0A337SW42_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K6GE31_BCL2L11      CSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K6GE31_BCL2L11      CSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-08       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-22       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F7HHA9_BCL2L11-03       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3HW02_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F6XMC1_BCL2L11-06       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F6XMC1_BCL2L11-04       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-21       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F7HHA9_BCL2L11-01       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3HW02_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-24       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-12       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F7HHA9_BCL2L11-06       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3HW02_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O54918_BCL2L11-01       CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
O88498_BCL2L11-01       CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A1U8BW10_BCL2L11      CPHGSPQGPLAPPASPGPSATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A287DFJ0_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K6GE31_BCL2L11      CSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K6GE31_BCL2L11      CSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F6XMC1_BCL2L11-07       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F6XMC1_BCL2L11-05       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F7HHA9_BCL2L11-02       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-16       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-09       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F7HHA9_BCL2L11-04       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-18       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3HW02_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K5CAB2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
F6XMC1_BCL2L11-03       CLHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6TRZ5_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6QIL2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5NU92_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5HZI7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5X2I7_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6E226_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K5Z8B6_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3M6I1_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2K6KJP8_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I2YQ13_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
O43521_BCL2L11-03       CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2I3HW02_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2R9CA99_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
A0A2J8JCT2_BCL2L11      CPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTD--
F1SU81_BCL2L11-02       CPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A337SW42_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTD--
W5PY58_BCL2L11-01       CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
F7A7D2_BCL2L11-01       CPQGSPLGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTD--
A0A286XJN2_BCL2L11      SPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A286XJN2_BCL2L11      SPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
G1SSY0_BCL2L11-01       CAHGSPQGPLAPSASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
H0XW23_BCL2L11-01       CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A1S3FHA8_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
A0A337SW42_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPFFIFVRRSSLLSRSSSGYFSFDTD--
G1LDR8_BCL2L11-01       CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
J9NWV6_BCL2L11-01       CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
F1SU81_BCL2L11-01       CPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTD--
                                                                          

U3IW89_BCL2L11-01       RSPAP-----MSCDKATQTPSPPCQAVSH---------------------
Q6JTU4_BCL2L11-01       RIGDE-----FNAYYARRLEK-----------------------------
G1MV54_BCL2L11-01       FLLCA----------------------------------ASRWRSHSLAE
G1PDJ5_BCL2L11-01       ----------------------------------------SMQQSQALPV
M3XHJ5_BCL2L11-01       HSPAP-----VSVHKATQTPSPSSQLIVHVQHCL------AQREQHPETH
R4G9R5_BCL2L11-01       ----------ISCFLYRDVPWR--RTGRRWCEAE-----TSRWQSRPIPE
B2KKY9_BCL2L11-01       SVPGSPLMPNISEAQDGQNDEVWLSEHSHQHLQM-----------AAPVA
B8JK68_BCL2L11-01       SVPGSPLMPNISEAQDGQNDEVWLSEHSHQHLQM-----------AAPVA
K7GA86_BCL2L11-01       RSPVP-----MSCDKSTQTPSPPCQAFNHYLSAMGKQDHASRWESPSIRE
G3SU55_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAINHYLSAM-----ASMRQSQALPA
G3W979_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM---DTASMRQSQSIPA
O43521_BCL2L11-11       -------------------VSLCHPGWSALVRSW-----LTATSNSQVQA
F7HHA9_BCL2L11-08       -------------------VSLCCPSWSALVLSW-----LTATSNSQVQA
A0A1U8BW10_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DLCENLKHEWQ
O54918_BCL2L11-03       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DQLENLNQVAQ
O43521_BCL2L11-19       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
O43521_BCL2L11-07       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEAAGSSL---
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSL--A
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLRIA
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLRIA
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLGIA
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DDSAGSSLRIA
O43521_BCL2L11-23       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DDSAGSSLRIA
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DDSAGSSLRIA
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DDSAGSSLRIA
F7HHA9_BCL2L11-07       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLGIA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATESSLGIA
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLGIA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----DEATGSSLGIA
C1KGB8_BCL2L11-01       ---------------------------------------ASMRQSQAEPA
A0A2K6GE31_BCL2L11      ---------------------------------------ASMRQFQAEPA
A0A337SW42_BCL2L11      ---------------------------------------ASMRQPQAVPA
O43521_BCL2L11-10       ---------------------------------------ASMRQAE--PA
O43521_BCL2L11-20       ---------------------------------------ASMRQAE--PA
A0A2I2YQ13_BCL2L11      ---------------------------------------ASMRQAE--PA
O43521_BCL2L11-17       ---------------------------------------ASMRQAE--PA
O43521_BCL2L11-13       ---------------------------------------ASMRQAE--PA
A0A2I3HW02_BCL2L11      ---------------------------------------ASMRQAE--PA
A0A2R9CA99_BCL2L11      ---------------------------------------ASMRQAE--PA
A0A2J8JCT2_BCL2L11      ---------------------------------------ASMRQAE--PA
A0A2K5NU92_BCL2L11      ---------------------------------------ASRRQAE--PA
A0A2K5X2I7_BCL2L11      ---------------------------------------ASRRQAE--PA
F7HHA9_BCL2L11-05       ---------------------------------------ASRRQAE--PA
A0A2K5Z8B6_BCL2L11      ---------------------------------------ASRRQAE--PA
A0A2K5HZI7_BCL2L11      ---------------------------------------ASRRQAE--PA
A0A2K6KJP8_BCL2L11      ---------------------------------------ASRRQAE--PA
A0A2K6QIL2_BCL2L11      ---------------------------------------ASRRQAE--PA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM------------GDIS
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDTS
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDTS
F6XMC1_BCL2L11-09       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVIRMDIGDIS
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVIRMDIGDIS
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDTS
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDLS
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDLS
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
F7HHA9_BCL2L11-09       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDSS
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDLS
O43521_BCL2L11-06       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDLS
O43521_BCL2L11-15       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDIGDLS
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VVILEDVGDIS
F1SU81_BCL2L11-03       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A0D9RWE0_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
O43521_BCL2L11-05       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-25       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O54918_BCL2L11-08       ---------------------------------------ASIRQSQEEPE
O54918_BCL2L11-06       ---------------------------------------ASIRQSQEEPE
A0A1U8BW10_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPA
Q2YDF0_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAVPA
A0A287DFJ0_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRESQAEPA
O54918_BCL2L11-05       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPE
O88498_BCL2L11-02       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPE
A0A2K6GE31_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQFQAEPA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-02       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
H2P5E2_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A337SW42_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQPQAVPA
A0A286XJN2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAGPP
A0A1S3FHA8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQEEPA
Q4KMV9_BCL2L11-01       -SPGP-----VSCDKSTQTPSPPCQAFNHLLSAM-----ADRN----PVN
F7FTC8_BCL2L11-01       RSPPP-----VSCDKSTQTPSPHCQAFNHYLSAM-----ASIRQPQSVPE
A0A2K6E226_BCL2L11      ------------CDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
M3YDI3_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRRQSQAVPA
F6XMC1_BCL2L11-02       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
F6XMC1_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
F7CXT2_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQSIPA
F6XMC1_BCL2L11-08       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GYRLTGQQPCL
A0A337SW42_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VRAIEEGVL--
A0A337SW42_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----------GLFE-
A0A2K6GE31_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM----------GIFE--
A0A2K6GE31_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
O43521_BCL2L11-08       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
O43521_BCL2L11-22       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
F7HHA9_BCL2L11-03       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
F6XMC1_BCL2L11-06       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV--
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ADWD-------
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ADWD-------
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
F6XMC1_BCL2L11-04       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
O43521_BCL2L11-21       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
F7HHA9_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GIFE-------
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
O43521_BCL2L11-24       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
O43521_BCL2L11-12       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
F7HHA9_BCL2L11-06       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ANWD-------
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----GVFE-------
O54918_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPE
O88498_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPE
A0A1U8BW10_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASIRQSQEEPA
A0A287DFJ0_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRESQAEPA
A0A2K6GE31_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQFQAEPA
A0A2K6GE31_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQFQAEPA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
F6XMC1_BCL2L11-07       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
F6XMC1_BCL2L11-05       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
F7HHA9_BCL2L11-02       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-16       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-09       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
F7HHA9_BCL2L11-04       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-18       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K5CAB2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
F6XMC1_BCL2L11-03       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6TRZ5_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6QIL2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5NU92_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5HZI7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5X2I7_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6E226_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K5Z8B6_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I3M6I1_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2K6KJP8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASRR--QAEPA
A0A2I2YQ13_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
O43521_BCL2L11-03       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2I3HW02_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2R9CA99_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
A0A2J8JCT2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMR--QAEPA
F1SU81_BCL2L11-02       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A337SW42_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQPQAVPA
W5PY58_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAVPA
F7A7D2_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAVPA
A0A286XJN2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAGPP
A0A286XJN2_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAGPP
G1SSY0_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
H0XW23_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
A0A1S3FHA8_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQEEPA
A0A337SW42_BCL2L11      RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQPQAVPA
G1LDR8_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAVPA
J9NWV6_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAVPA
F1SU81_BCL2L11-01       RSPAP-----MSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQSQAEPA
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       EIQPEIWIAQELRRIGDEFNASY-CPRRGFLDNH---AGN--PQVVILRL
G1PDJ5_BCL2L11-01       DMRPEMWIAQELRRIGDEFNNSYRNPRRDFLNVYREAEGH--PQMVVLRL
M3XHJ5_BCL2L11-01       GKNPLNFT------------------------------------------
R4G9R5_BCL2L11-01       DMQPEIWIAQELRRIGDEFNASHCPRRGFLDYQAVN------HQIIILRL
B2KKY9_BCL2L11-01       ALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLRAPNEHA--IVLWMNVI
B8JK68_BCL2L11-01       ALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLHAPNEHA--IVLWMNDI
K7GA86_BCL2L11-01       DMQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAI-------NHQIVLRL
G3SU55_BCL2L11-01       DLRPEIWIARELRRIGDEFNAYYPRRAFL-NNYQAAEDH---PQMVILRL
G3W979_BCL2L11-01       DMRPEIWIAQELRRIGDEFNASYPRRGFLDNNYQAADDH---HQMVILRL
O43521_BCL2L11-11       VLLPQPPK------------------------------------------
F7HHA9_BCL2L11-08       VLLPQPPK------------------------------------------
A0A1U8BW10_BCL2L11      -IHGDQSKS-----------------------------------------
O54918_BCL2L11-03       NIHGDAWYN-----------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      ----EVQWPFEWLAKSS---------------------------------
A0A2K6TRZ5_BCL2L11      -LRREVQCPLEWLAKSS---------------------------------
A0A2K5HZI7_BCL2L11      -LHREVQ-------------------------------------------
A0A2K5NU92_BCL2L11      -LHREVQWPLECLASS----------------------------------
A0A2K5Z8B6_BCL2L11      -LHREVQWPLECLASS----------------------------------
A0A2I2YQ13_BCL2L11      -LHREVQWPLEWLAKSS---------------------------------
O43521_BCL2L11-23       -LHREVQWPLKWLAKSS---------------------------------
A0A2R9CA99_BCL2L11      -LHREVQWPLKWLAKSS---------------------------------
A0A2J8JCT2_BCL2L11      -LHREVQWPLKWLAKSS---------------------------------
F7HHA9_BCL2L11-07       -LHREVQWPLEWLA------------------------------------
A0A2K5CAB2_BCL2L11      -LRREVQWPLEWLAKSS---------------------------------
A0A2K5X2I7_BCL2L11      -LHREVQWPLEWLASS----------------------------------
A0A2I3M6I1_BCL2L11      -LHREVQWPLEWLASS----------------------------------
C1KGB8_BCL2L11-01       DMRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTL--PPPYI---
A0A2K6GE31_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYPRRLAKCLVPSI---------------
A0A337SW42_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYPRRLARVPASYI---------------
O43521_BCL2L11-10       DMRPEIWIAQELRRIGDEFNAYYARRMPLPPD------------------
O43521_BCL2L11-20       DMRPEIWIAQELRRIGDEFNAYYARRMPLPPD------------------
A0A2I2YQ13_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---------------
O43521_BCL2L11-17       DMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---------------
O43521_BCL2L11-13       DMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2I3HW02_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2R9CA99_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRLAKLLSST----------------
A0A2J8JCT2_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2K5NU92_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAELLASST---------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAELLASST---------------
F7HHA9_BCL2L11-05       DMRPEIRIAQELRRIGDEFNAYYARRLAELLASST---------------
A0A2K5Z8B6_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAELLASST---------------
A0A2K5HZI7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLAKLLASST---------------
A0A2K5CAB2_BCL2L11      LWFRFIFTFFDLYG-------------------HHHSQGT--EQLHHKYF
A0A2K5Z8B6_BCL2L11      L-FGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2K6KJP8_BCL2L11      LWFGFIFTGLDLYVV--------------WIYIYHHSQDT--EQLNHRDF
A0A2K6QIL2_BCL2L11      LWFGFIFTGLDLYVV--------------WIYIYHHSQDT--EQLNHRDF
F6XMC1_BCL2L11-09       LWFRFTFTFFDLCG-------------------HHHSQGT--EQQHKDFS
A0A2K6TRZ5_BCL2L11      LWFRFIFTFFDLYG-------------------YHHSQGT--EQLHHKYV
A0A2K5HZI7_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHRDF
A0A2R9CA99_BCL2L11      LCFGFIFTGLDLYG-------------------HHHSQDA--EQLNHKDF
A0A2J8JCT2_BCL2L11      LCFGFIFTGLDLYG-------------------HHHSQDA--EQLNHKDF
A0A2K5NU92_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2K5X2I7_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
F7HHA9_BCL2L11-09       LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2K6E226_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2I3M6I1_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2I2YQ13_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
O43521_BCL2L11-06       LCFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
O43521_BCL2L11-15       LCFGFIFTGLDLYG-------------------HHHSQDT--EQLNHKDF
A0A2I3HW02_BCL2L11      LWFGFIFTGLDLYG-------------------HHHSQDT--EQFNHKDF
F1SU81_BCL2L11-03       DMRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTL--PPPYI---
A0A0D9RWE0_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRLEK---------------------
O43521_BCL2L11-05       DMRPEIWIAQELRRIGDEFNAYYARRLEK---------------------
O43521_BCL2L11-25       DMRPEIWIAQELRRIGDEFNAYYARRLEK---------------------
O54918_BCL2L11-08       DLRPEIRIAQELRRIGDEFNETYTRRV--FANDYREAEDH--PQMVILQL
O54918_BCL2L11-06       DLRPEIRIAQELRRIGDEFNETYTRRV--FANDYREAEDH--PQMVILQL
A0A1U8BW10_BCL2L11      DIRPEIWIAQELRRIGDEFNESYRRRVNNYQEDEDH-PHH--PQMVILQL
Q2YDF0_BCL2L11-01       DTRPEIWIAQELRRIGDEFNAYYPRRV--FVRHQAV-EGH--PQMVLLRV
A0A287DFJ0_BCL2L11      DMRPEIWIAQELRRIGDEFNLYYPRRV--FFNNYQP-EDR--PQMVILRL
O54918_BCL2L11-05       DLRPEIRIAQELRRIGDEFNETYTRRV--FANDYREAEDH--PQMVILQL
O88498_BCL2L11-02       DLRPEIRIAQELRRIGDEFNETYTRRA--FANDYREAEDH--PQMVILQL
A0A2K6GE31_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYPRRV--FLNNYQADEDH--PQMLILRL
A0A2K5CAB2_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRV--FLNNYQAAEDH--PHMVILRL
A0A2K6TRZ5_BCL2L11      GMRPEIWIAQELRRIGDEFNAYYPRRV--FLNNYQAAEDH--PHMVILRL
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEEH--PQMVILRL
A0A2K5NU92_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2K5HZI7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2K5Z8B6_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2I3M6I1_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2I3M6I1_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PQMVILRL
A0A2I2YQ13_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PRMVILRL
O43521_BCL2L11-02       DMRPEIWIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PRMVILRL
A0A2R9CA99_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PRMVILRL
A0A2J8JCT2_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PRMVILRL
H2P5E2_BCL2L11-01       DMRPEIWIAQELRRIGDEFNAYYARRV--FLNNYQAAEDH--PRMVILRL
A0A337SW42_BCL2L11      DMRPEIWIAQELRRIGDEFNAYYPRRV--FLNNYQAAEAQ--PQMIILRL
A0A286XJN2_BCL2L11      HLRPEIWIAQELRRIGDEFNASYPRRV--FLNHYQPAEDQ--PQMVILRL
A0A1S3FHA8_BCL2L11      DLRPEIWIAQELRRIGDEFDAYYPRRV--FLNNYQAAEDQ--PQMVILRL
Q4KMV9_BCL2L11-01       QMSPELWIAQELRRIGDDFNASFSPRRGIFNNLPRPLDN---DQVIILRV
F7FTC8_BCL2L11-01       DMRPEIWIAQELRRIGDEFNASYCPRRGLLDNNNPAGNN---HQMGFVHL
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
M3YDI3_BCL2L11-01       DMRPEMWIAQELRRIGDEFNA-YYPRRVFLNNYPAAEAH---PQMIILRL
F6XMC1_BCL2L11-02       GMRPEIWIAQELRRIGDEFNA-YYPRRVNWILPFCHRKEVCLEAFPVLPS
F6XMC1_BCL2L11-01       GMRPEIWIAQELRRIGDEFNA-YYPRRVNWILPFCHRKEVCLEAFPVLPS
F7CXT2_BCL2L11-01       DMRPEIWIAQELRRIGDEFNASYYPRRGFLDNNYQGAGDH--HQMVILRL
F6XMC1_BCL2L11-08       PWKVRGIGEKQEERVNPHTWE-TFKSTRTHSLSARNSIHP----------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       DLRPEIRIAQELRRIGDEFNE-TYTRRVFANDYREAEDH---PQMVILQL
O88498_BCL2L11-01       DLRPEIRIAQELRRIGDEFNE-TYTRRAFANDYREAEDH---PQMVILQL
A0A1U8BW10_BCL2L11      DIRPEIWIAQELRRIGDEFNE-SYRRRV--NNYQEDEDHPHHPQMVILQL
A0A287DFJ0_BCL2L11      DMRPEIWIAQELRRIGDEFNL-YYPRRVFFNNYQPEDR----PQMVILRL
A0A2K6GE31_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYPRRMPLPSD-----------------
A0A2K6GE31_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQADEDH---PQMLILRL
A0A2K5CAB2_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRLEK--------------------
F6XMC1_BCL2L11-07       GMRPEIWIAQELRRIGDEFNA-YYPRRLEK--------------------
A0A2K6TRZ5_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRLEK--------------------
F6XMC1_BCL2L11-05       GMRPEIWIAQELRRIGDEFNA-YYPRRISLLPD-----------------
A0A2K6TRZ5_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRISLPPD-----------------
A0A2K5CAB2_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRISLPSD-----------------
A0A2K5NU92_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K5HZI7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
F7HHA9_BCL2L11-02       DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K5Z8B6_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2I3M6I1_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRMSLPPD-----------------
A0A2I2YQ13_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRMPLPPD-----------------
O43521_BCL2L11-16       DMRPEIWIAQELRRIGDEFNA-YYARRMPLPPD-----------------
O43521_BCL2L11-09       DMRPEIWIAQELRRIGDEFNA-YYARRMPLPPD-----------------
A0A2R9CA99_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRMPLPPD-----------------
A0A2J8JCT2_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRMPLPPD-----------------
A0A2K5NU92_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K5HZI7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
F7HHA9_BCL2L11-04       DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K5Z8B6_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2I3M6I1_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2I2YQ13_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRLEK--------------------
O43521_BCL2L11-18       DMRPEIWIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2I3HW02_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2R9CA99_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2J8JCT2_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRLEK--------------------
A0A2K5CAB2_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEDH---PHMVILRL
A0A2K5CAB2_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEDH---PHMVILRL
F6XMC1_BCL2L11-03       GMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEDH---PHMVILRL
A0A2K6TRZ5_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEDH---PHMVILRL
A0A2K6TRZ5_BCL2L11      GMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEDH---PHMVILRL
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEEH---PQMVILRL
A0A2K6QIL2_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEEH---PQMVILRL
A0A2K5NU92_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K5HZI7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K5X2I7_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K6E226_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K5Z8B6_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2I3M6I1_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2K6KJP8_BCL2L11      DMRPEIRIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PQMVILRL
A0A2I2YQ13_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PRMVILRL
O43521_BCL2L11-03       DMRPEIWIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PRMVILRL
A0A2I3HW02_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PRMVILRL
A0A2R9CA99_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PRMVILRL
A0A2J8JCT2_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYARRVFLNNYQAAEDH---PRMVILRL
F1SU81_BCL2L11-02       DMRPEIWIAQELRRIGDEFNA-YYPRRVMLFSLPPFSPHTLPPPYI----
A0A337SW42_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYPRRLEQ--------------------
W5PY58_BCL2L11-01       DTRPEIWIAQELRRIGDEFNA-YYPRRVFV-RHQAIEGH---PQMVLLRV
F7A7D2_BCL2L11-01       DMRPEVWIAQELRRIGDEFNA-SYPRRVVLNHHQAAEAH---PQMIILRL
A0A286XJN2_BCL2L11      HLRPEIWIAQELRRIGDEFNA-SYPRRVFLNHYQPAEDQ---PQMVILRL
A0A286XJN2_BCL2L11      HLRPEIWIAQELRRIGDEFNA-SYPRRVFLNHYQPAEDQ---PQMVILRL
G1SSY0_BCL2L11-01       DTRPETWIAQELRRIGDEFNA-YYPRRVFLNNYPAAEEQ---PQMVILRL
H0XW23_BCL2L11-01       DLRPEMWIAQELRRIGDEFNA-YYPTRVFLHNYQAAEDH---PQMVILRL
A0A1S3FHA8_BCL2L11      DLRPEIWIAQELRRIGDEFDA-YYPRRVFLNNYQAAEDQ---PQMVILRL
A0A337SW42_BCL2L11      DMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEAQ---PQMIILRL
G1LDR8_BCL2L11-01       DMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEAH---PQMIILRL
J9NWV6_BCL2L11-01       DMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEAH---PQMIILRL
F1SU81_BCL2L11-01       DMRPEIWIAQELRRIGDEFNA-YYPRRVFLNNYQAAEAH---PQMVILRL
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       LHYIIRLIWRMQ--------------------------------------
G1PDJ5_BCL2L11-01       LRYILRLVWRRM--------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       LHYIVRFIWRMQ--------------------------------------
B2KKY9_BCL2L11-01       IGRLVHFFLRRR--------------------------------------
B8JK68_BCL2L11-01       IGRLVHFFLRRR--------------------------------------
K7GA86_BCL2L11-01       LHYIIRLIWRMQ--------------------------------------
G3SU55_BCL2L11-01       LRYIVRLVWR----------------------------------------
G3W979_BCL2L11-01       LHYIIRLVWRMQ--------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
A0A1U8BW10_BCL2L11      --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      S-------------------------------------------------
A0A2K5Z8B6_BCL2L11      S-------------------------------------------------
A0A2K6KJP8_BCL2L11      S-------------------------------------------------
A0A2K6QIL2_BCL2L11      S-------------------------------------------------
F6XMC1_BCL2L11-09       W-------------------------------------------------
A0A2K6TRZ5_BCL2L11      S-------------------------------------------------
A0A2K5HZI7_BCL2L11      S-------------------------------------------------
A0A2R9CA99_BCL2L11      S-------------------------------------------------
A0A2J8JCT2_BCL2L11      S-------------------------------------------------
A0A2K5NU92_BCL2L11      S-------------------------------------------------
A0A2K5X2I7_BCL2L11      S-------------------------------------------------
F7HHA9_BCL2L11-09       S-------------------------------------------------
A0A2K6E226_BCL2L11      S-------------------------------------------------
A0A2I3M6I1_BCL2L11      S-------------------------------------------------
A0A2I2YQ13_BCL2L11      S-------------------------------------------------
O43521_BCL2L11-06       S-------------------------------------------------
O43521_BCL2L11-15       S-------------------------------------------------
A0A2I3HW02_BCL2L11      S-------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-08       LRFIFRLVWRRH--------------------------------------
O54918_BCL2L11-06       LRFIFRLVWRRH--------------------------------------
A0A1U8BW10_BCL2L11      LRFIVRLVWRRH--------------------------------------
Q2YDF0_BCL2L11-01       LRYIVRLVWRMQ--------------------------------------
A0A287DFJ0_BCL2L11      LRCIIRLVWRMH--------------------------------------
O54918_BCL2L11-05       LRFIFRLVWRRH--------------------------------------
O88498_BCL2L11-02       LRFIFRLVWRRH--------------------------------------
A0A2K6GE31_BCL2L11      LRYIVRLVWRRH--------------------------------------
A0A2K5CAB2_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6TRZ5_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6QIL2_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5NU92_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5HZI7_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5X2I7_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6E226_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5Z8B6_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2I3M6I1_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2I3M6I1_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6KJP8_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2I2YQ13_BCL2L11      LRYIVRLVWRMH--------------------------------------
O43521_BCL2L11-02       LRYIVRLVWRMH--------------------------------------
A0A2R9CA99_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2J8JCT2_BCL2L11      LRYIVRLVWRMH--------------------------------------
H2P5E2_BCL2L11-01       LRYIVRLVWRMH--------------------------------------
A0A337SW42_BCL2L11      LRYIVRLVWRLQ--------------------------------------
A0A286XJN2_BCL2L11      LRYIIRLVWRMH--------------------------------------
A0A1S3FHA8_BCL2L11      LRYIIRLVWRMH--------------------------------------
Q4KMV9_BCL2L11-01       LRFIIRLILRL---------------------------------------
F7FTC8_BCL2L11-01       LRYIIRRVWRLQ--------------------------------------
A0A2K6E226_BCL2L11      LRYIVRLVWRMH--------------------------------------
M3YDI3_BCL2L11-01       LRYIIRLVWRLQ--------------------------------------
F6XMC1_BCL2L11-02       KASQSAYWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLV
F6XMC1_BCL2L11-01       KASQSAYWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLV
F7CXT2_BCL2L11-01       LRYIIRLVWRMQ--------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
O54918_BCL2L11-01       LRFIFRLVWRRH--------------------------------------
O88498_BCL2L11-01       LRFIFRLVWRRH--------------------------------------
A0A1U8BW10_BCL2L11      LRFIVRLVWRRH--------------------------------------
A0A287DFJ0_BCL2L11      LRCIIRLVWRMH--------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      LRYIVRLVWRRH--------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5CAB2_BCL2L11      LRYIVRLVWRMH--------------------------------------
F6XMC1_BCL2L11-03       LRYIVRLVWRMH--------------------------------------
A0A2K6TRZ5_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6TRZ5_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6QIL2_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6QIL2_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5NU92_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5HZI7_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5X2I7_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6E226_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6E226_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K5Z8B6_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2I3M6I1_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6KJP8_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2K6KJP8_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2I2YQ13_BCL2L11      LRYIVRLVWRMH--------------------------------------
O43521_BCL2L11-03       LRYIVRLVWRMH--------------------------------------
A0A2I3HW02_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2R9CA99_BCL2L11      LRYIVRLVWRMH--------------------------------------
A0A2J8JCT2_BCL2L11      LRYIVRLVWRMH--------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       LRYLVRLVWRMQ--------------------------------------
F7A7D2_BCL2L11-01       LRYIIRLVRRLQ--------------------------------------
A0A286XJN2_BCL2L11      LRYIIRLVWRMH--------------------------------------
A0A286XJN2_BCL2L11      LRYIIRLVWRMH--------------------------------------
G1SSY0_BCL2L11-01       LRYIVRLVWRMH--------------------------------------
H0XW23_BCL2L11-01       LRYIVRLVWRLH--------------------------------------
A0A1S3FHA8_BCL2L11      LRYIIRLVWRMH--------------------------------------
A0A337SW42_BCL2L11      LRYIVRLVWRLQ--------------------------------------
G1LDR8_BCL2L11-01       LRYIVRLVWRLQ--------------------------------------
J9NWV6_BCL2L11-01       LRYIVRLVWRLQ--------------------------------------
F1SU81_BCL2L11-01       LRYIARLVWRMQ--------------------------------------
                                                                          

U3IW89_BCL2L11-01       ----------------------
Q6JTU4_BCL2L11-01       ----------------------
G1MV54_BCL2L11-01       ----------------------
G1PDJ5_BCL2L11-01       ----------------------
M3XHJ5_BCL2L11-01       ----------------------
R4G9R5_BCL2L11-01       ----------------------
B2KKY9_BCL2L11-01       ----------------------
B8JK68_BCL2L11-01       ----------------------
K7GA86_BCL2L11-01       ----------------------
G3SU55_BCL2L11-01       ----------------------
G3W979_BCL2L11-01       ----------------------
O43521_BCL2L11-11       ----------------------
F7HHA9_BCL2L11-08       ----------------------
A0A1U8BW10_BCL2L11      ----------------------
O54918_BCL2L11-03       ----------------------
O43521_BCL2L11-19       ----------------------
O43521_BCL2L11-07       ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-23       ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
F7HHA9_BCL2L11-07       ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
C1KGB8_BCL2L11-01       ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A337SW42_BCL2L11      ----------------------
O43521_BCL2L11-10       ----------------------
O43521_BCL2L11-20       ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-17       ----------------------
O43521_BCL2L11-13       ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-05       ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
F6XMC1_BCL2L11-09       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-09       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-06       ----------------------
O43521_BCL2L11-15       ----------------------
A0A2I3HW02_BCL2L11      ----------------------
F1SU81_BCL2L11-03       ----------------------
A0A0D9RWE0_BCL2L11      ----------------------
O43521_BCL2L11-05       ----------------------
O43521_BCL2L11-25       ----------------------
O54918_BCL2L11-08       ----------------------
O54918_BCL2L11-06       ----------------------
A0A1U8BW10_BCL2L11      ----------------------
Q2YDF0_BCL2L11-01       ----------------------
A0A287DFJ0_BCL2L11      ----------------------
O54918_BCL2L11-05       ----------------------
O88498_BCL2L11-02       ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-02       ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
H2P5E2_BCL2L11-01       ----------------------
A0A337SW42_BCL2L11      ----------------------
A0A286XJN2_BCL2L11      ----------------------
A0A1S3FHA8_BCL2L11      ----------------------
Q4KMV9_BCL2L11-01       ----------------------
F7FTC8_BCL2L11-01       ----------------------
A0A2K6E226_BCL2L11      ----------------------
M3YDI3_BCL2L11-01       ----------------------
F6XMC1_BCL2L11-02       LKDGGPVVKSALKLPWFHSPVA
F6XMC1_BCL2L11-01       LKDGGPVVKSALKLPWFHSPVA
F7CXT2_BCL2L11-01       ----------------------
F6XMC1_BCL2L11-08       ----------------------
A0A337SW42_BCL2L11      ----------------------
A0A337SW42_BCL2L11      ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-08       ----------------------
O43521_BCL2L11-22       ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-03       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
F6XMC1_BCL2L11-06       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
F6XMC1_BCL2L11-04       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-21       ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-01       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-24       ----------------------
O43521_BCL2L11-12       ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-06       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
O54918_BCL2L11-01       ----------------------
O88498_BCL2L11-01       ----------------------
A0A1U8BW10_BCL2L11      ----------------------
A0A287DFJ0_BCL2L11      ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A2K6GE31_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
F6XMC1_BCL2L11-07       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
F6XMC1_BCL2L11-05       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-02       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-16       ----------------------
O43521_BCL2L11-09       ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
F7HHA9_BCL2L11-04       ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-18       ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
A0A2K5CAB2_BCL2L11      ----------------------
F6XMC1_BCL2L11-03       ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K6TRZ5_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K6QIL2_BCL2L11      ----------------------
A0A2K5NU92_BCL2L11      ----------------------
A0A2K5HZI7_BCL2L11      ----------------------
A0A2K5X2I7_BCL2L11      ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K6E226_BCL2L11      ----------------------
A0A2K5Z8B6_BCL2L11      ----------------------
A0A2I3M6I1_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2K6KJP8_BCL2L11      ----------------------
A0A2I2YQ13_BCL2L11      ----------------------
O43521_BCL2L11-03       ----------------------
A0A2I3HW02_BCL2L11      ----------------------
A0A2R9CA99_BCL2L11      ----------------------
A0A2J8JCT2_BCL2L11      ----------------------
F1SU81_BCL2L11-02       ----------------------
A0A337SW42_BCL2L11      ----------------------
W5PY58_BCL2L11-01       ----------------------
F7A7D2_BCL2L11-01       ----------------------
A0A286XJN2_BCL2L11      ----------------------
A0A286XJN2_BCL2L11      ----------------------
G1SSY0_BCL2L11-01       ----------------------
H0XW23_BCL2L11-01       ----------------------
A0A1S3FHA8_BCL2L11      ----------------------
A0A337SW42_BCL2L11      ----------------------
G1LDR8_BCL2L11-01       ----------------------
J9NWV6_BCL2L11-01       ----------------------
F1SU81_BCL2L11-01       ----------------------
                                              

© 1998-2018