Dataset for protein Bim of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

262 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
A0A3Q1ICY2_BCL2L11      --------------------------------------------------
A0A3Q3K6I5_BCL2L11      --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3Q3ESW6_BCL2L11      --------------------------------------------------
A0A3Q2SZH6_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3G3M2M0_BCL2L11      --------------------------------------------------
A0A3Q1ELG4_BCL2L11      --------------------------------------------------
A0A3Q1CI15_BCL2L11      --------------------------------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
A0A3Q2U844_BCL2L11      --------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGL
A0A3Q2GRS5_BCL2L11      MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGL
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452SBG5_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       -MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRL
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       ---------------------------------------------MRQAE
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       ---------------------------------MPTEESLQFDKDQGTSD
R4G9R5_BCL2L11-01       -------------------------------------------MLVVGSS
A0A3P8RLE2_BCL2L11      -------------------------------------------ANRTPSL
A0A3B1JXK6_BCL2L11      ---------------------------------------------MSRPS
A0A3B4BVX1_BCL2L11      --------------------LLSARKARFSVCPCSSPEDRIHHLPHYLRS
A0A3B4BVX1_BCL2L11      -------------------------------------------------M
A0A3B4BVX1_BCL2L11      ---------------------------------------------MSRRS
A0A3P8XIA2_BCL2L11      -----------------------------------------MFDSSRPQN
A0A3Q1ICY2_BCL2L11      -------------------------------------------MDPRQPN
A0A3Q3K6I5_BCL2L11      ------------------------------------------MHLSRPPN
A0A3B4V919_BCL2L11      ------------------------------MKAQADGAALFIQQTTKPVR
A0A3B4XZH1_BCL2L11      ------------------------------MKAQADGAALFIQQTTKPVR
A0A3Q3ESW6_BCL2L11      -----------------------------------------MHRPSRPPN
A0A3Q2SZH6_BCL2L11      --------------------------------------MVTLCSSNRPPN
A0A3B3VNE0_BCL2L11      ------------------------------------------MHSSRPPN
A0A3B3YII5_BCL2L11      ------------------------------------------MHSLRPPN
A0A3B3YII5_BCL2L11      ------------------------------------------MHSLRPPN
A0A3P9N073_BCL2L11      --------------------------------------------------
A0A3Q3B113_BCL2L11      -----------------------------------------MRSPSRPPN
A0A3B5M375_BCL2L11      ------------------------------------MLTVTLCSSNRPPN
A0A3B5QAM1_BCL2L11      ------------------------------------------MHSLRPPN
A0A3B5QAM1_BCL2L11      ------------------------------------MLTVTLCSSNRPPN
A0A3G3M2M0_BCL2L11      -------------------------------------------MSDTSRE
A0A3Q1ELG4_BCL2L11      -------------------------------------------SSSAASP
A0A3Q1CI15_BCL2L11      -------------------------------------------PTKSGPD
A0A3Q3SYA1_BCL2L11      -------------------------------------------MATEESG
B2KKY9_BCL2L11-01       ----------------------------------MSDTSREQTLANGPAS
B8JK68_BCL2L11-01       ----------------------------------MSDTSREQTLANGPAS
A0A3B3QC78_BCL2L11      ---------------------------------------MGQILLTIPCS
A0A3Q2U844_BCL2L11      -------------------------------------------MAKQPPE
G3SU55_BCL2L11-01       -------------------------------------------MAKQPSD
G3W979_BCL2L11-01       -------------------------------------------MAKQPSD
A0A3P8XIA2_BCL2L11      ----------------------------------------------RESS
K7GA86_BCL2L11-01       AEELLLEPDSLLFRQSLSASYSLDAGKGDQ-------------MAKQPSD
A0A3Q2GRS5_BCL2L11      CLPRCLSGDNQGAPGRRKARAGRRGARARTRRSEGKGRIKKDQMAKQPSD
Q4KMV9_BCL2L11-01       -------------------------------------------MAKQPSV
F7FTC8_BCL2L11-01       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-11       -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-08       -------------------------------------------MAKQPSD
O54918_BCL2L11-06       -------------------------------------------MAKQPSD
O54918_BCL2L11-08       -------------------------------------------MAKQPSD
O54918_BCL2L11-03       -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-15       -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-07       -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-07       -------------------------------------------MAKQPSD
O43521_BCL2L11-22       -------------------------------------------MAKQPSD
A0A452U4S4_BCL2L11      -------------------------------------------MAKQPSD
C1KGB8_BCL2L11-01       -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-17       -------------------------------------------MAKQPSD
O43521_BCL2L11-10       -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-19       -------------------------------------------MAKQPSD
O43521_BCL2L11-13       -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-05       -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
O54918_BCL2L11-05       -------------------------------------------MAKQPSD
O88498_BCL2L11-02       -------------------------------------------MAKQPSD
A0A0D9RWE0_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-05       -------------------------------------------MAKQPSD
O43521_BCL2L11-25       -------------------------------------------MAKQPSD
F1SU81_BCL2L11-03       -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
A0A286XJN2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-02       -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
H2P5E2_BCL2L11-01       -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
A0A452SBG5_BCL2L11      -------------------------------------------MAKQPSD
Q2YDF0_BCL2L11-01       -----------MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSD
A0A287DFJ0_BCL2L11      -------------------------------------------MAKQPSD
Q2YDF0_BCL2L11-03       -------------------------------------------MAKQPSD
A0A452FCS1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-09       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-09       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-06       -------------------------------------------MAKQPSD
O43521_BCL2L11-23       -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
M3YDI3_BCL2L11-01       CLPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSD
F6XMC1_BCL2L11-02       -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-01       -------------------------------------------MAKQPSD
F7CXT2_BCL2L11-01       -------------------------------------------MAKQPSD
O54918_BCL2L11-01       -------------------------------------------MAKQPSD
O88498_BCL2L11-01       -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-24       -------------------------------------------MAKQPSD
O43521_BCL2L11-08       -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-03       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-06       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-04       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-18       -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-01       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-16       -------------------------------------------MAKQPSD
O43521_BCL2L11-12       -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-06       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-08       -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6GE31_BCL2L11      -------------------------------------------MAKQPSD
A0A287DFJ0_BCL2L11      -------------------------------------------MAKQPSD
A0A286XJN2_BCL2L11      -------------------------------------------MAKQPSD
A0A286XJN2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-07       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-05       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-02       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-09       -------------------------------------------MAKQPSD
O43521_BCL2L11-21       -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
F7HHA9_BCL2L11-04       -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-20       -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5CAB2_BCL2L11      -------------------------------------------MAKQPSD
F6XMC1_BCL2L11-03       -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6TRZ5_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6QIL2_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5NU92_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5HZI7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5X2I7_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6E226_BCL2L11      -------------------------------------------MAKQPSD
A0A2K5Z8B6_BCL2L11      -------------------------------------------MAKQPSD
A0A2I3M6I1_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2K6KJP8_BCL2L11      -------------------------------------------MAKQPSD
A0A2I2YQ13_BCL2L11      -------------------------------------------MAKQPSD
O43521_BCL2L11-03       -------------------------------------------MAKQPSD
A0A2I3HW02_BCL2L11      -------------------------------------------MAKQPSD
A0A2R9CA99_BCL2L11      -------------------------------------------MAKQPSD
A0A2J8JCT2_BCL2L11      -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
A0A452FCS1_BCL2L11      -------------------------------------------MAKQPSD
W5PY58_BCL2L11-01       -------------------------------------------MAKQPSD
Q2YDF0_BCL2L11-02       -------------------------------------------MAKQPSD
F1SU81_BCL2L11-02       -------------------------------------------MAKQPSD
G1SSY0_BCL2L11-01       -------------------------------------------MAKQPSD
H0XW23_BCL2L11-01       -------------------------------------------MAKQPSD
A0A337SW42_BCL2L11      -------------------------------------------MAKQPSD
G1LDR8_BCL2L11-01       -------------------------------------------MAKQPSD
J9NWV6_BCL2L11-01       -------------------------------------------MAKQPSD
F1SU81_BCL2L11-01       -------------------------------------------MAKQPSD
                                                                          

Q6JTU4_BCL2L11-01       -----------------------------PADMRP---------------
G1MV54_BCL2L11-01       ------------------------------------F-------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------VISECGH-----LHPTQRPDQPPFVKQEGCYCIISPLSKVIA
R4G9R5_BCL2L11-01       -----------------------------QPQLCL-------LPKQL---
A0A3P8RLE2_BCL2L11      --------VGPEQKKRNGGNLRGGGA---DPEPVG-A-----AGVSAKTS
A0A3B1JXK6_BCL2L11      NRATRPPFLKEQGER-GQSGG--------GGGTLS-R-----AEQCEQPE
A0A3B4BVX1_BCL2L11      NRAGRPAFLKEQGES-GQSSG--------AASSRA-------AEQCEQPE
A0A3B4BVX1_BCL2L11      QNSNYCCF--EQGES-GQSSG---------AASSR-A-----AEQCEQPE
A0A3B4BVX1_BCL2L11      NRAGRPAFLKEQGES-GQSSG---------AASSR-A-----AEQCEQPE
A0A3P8XIA2_BCL2L11      RSNGTTTLIGRGKIG-ESHPCGGATS---SSKLSD-Y-----PQSC----
A0A3Q1ICY2_BCL2L11      RSDGSTAVTATGESG-GDPPPVGAAG---VSTPTS-R-----SNDGGERR
A0A3Q3K6I5_BCL2L11      RSDGSTAVTATEES--GDPPSVGAAG---TSAQSS-R-----SNGGSERS
A0A3B4V919_BCL2L11      WLDRSNG-KRGERRG-STTRR--CRW---SPSAKP-Q-----FER-----
A0A3B4XZH1_BCL2L11      WLDRSNG-KRGERRG-STTRR--CRW---SPGAKP-Q-----FER-----
A0A3Q3ESW6_BCL2L11      RLDGSPTVTESHGTR-GDPPQ--TSR---S-------------DNSGGRN
A0A3Q2SZH6_BCL2L11      LRDGSTEVTPPEGTG-GDPAS--SAR---TPRLSK-H-----REGSCAQP
A0A3B3VNE0_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSCAPQ
A0A3B3YII5_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSCAPQ
A0A3B3YII5_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSCAPQ
A0A3P9N073_BCL2L11      -----------------DPAS--SAR---TPRSSK-H-----TERSCAPQ
A0A3Q3B113_BCL2L11      LRDGSTEVKATEGSS-GGAPP--SAG---AARGSA-H-----ATR---PV
A0A3B5M375_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSRAPQ
A0A3B5QAM1_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSRAPQ
A0A3B5QAM1_BCL2L11      LLDGSTEVTPAEGTG-GDPAS--SAR---TPRSSK-H-----TERSRAPQ
A0A3G3M2M0_BCL2L11      --------QTPGNVPASRGSGESAGV---GAALRP-G--HFDFPQPSDGD
A0A3Q1ELG4_BCL2L11      --------AAPHADTTEGGGADPEPV---GAAGVS-A--KTSRSNSTGGE
A0A3Q1CI15_BCL2L11      --------AAARCFTSGSRCRDSERL----------------PPNPSHGS
A0A3Q3SYA1_BCL2L11      DPPAGDPRVSAQTSRSNGGTDQSSVS---PSRGRT-R-----SIAHLDSL
B2KKY9_BCL2L11-01       --------QGSGEST-GGGVVLPAGH---FDFPQP-G-------------
B8JK68_BCL2L11-01       --------QGSGEST-GGGVVLPAGH---FDFPQP-G-------------
A0A3B3QC78_BCL2L11      --------VCSAEDK-ITRMAESRNPVAEQTPIQA-GPRTAKVPGQLQAT
A0A3Q2U844_BCL2L11      --------AKAPRDR-RAGRLPPGEGPGPAVPLRP-G-----APAALPGA
G3SU55_BCL2L11-01       --------VSSECDR-EGGQLQPAERPPQPPQLRP-G-----APTSLLTE
G3W979_BCL2L11-01       --------LNSECDR-EGGQLQPTERPTQ-PQLRP-G-----APTSIQTQ
A0A3P8XIA2_BCL2L11      --------CEGNQQS-RGGIMMPTNS---LLGFQS-R-----SPLFRTTS
K7GA86_BCL2L11-01       --------LNSECDG-EGGQFQSIERPSQPQHLRP-G-----APTSIQTQ
A0A3Q2GRS5_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQIE
Q4KMV9_BCL2L11-01       --------LSPDCNSGEGGQLQSTSRQHSHRPLRR-G-----APTSLSSP
F7FTC8_BCL2L11-01       --------LNSECDS-EGGRLEPAEGPAQPPQLRP-G-----APTSIRTQ
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTD
O43521_BCL2L11-11       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-08       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O54918_BCL2L11-06       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
O54918_BCL2L11-08       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
O54918_BCL2L11-03       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-15       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-07       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-07       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-22       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A452U4S4_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
C1KGB8_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-17       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-10       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-19       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-13       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-05       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O54918_BCL2L11-05       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
O88498_BCL2L11-02       --------VNSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A0D9RWE0_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-05       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-25       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F1SU81_BCL2L11-03       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
A0A286XJN2_BCL2L11      --------VSCECDR-EGGQLQPAER---PSQLRA-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-02       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
H2P5E2_BCL2L11-01       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A452SBG5_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
Q2YDF0_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A287DFJ0_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
Q2YDF0_BCL2L11-03       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A452FCS1_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-09       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-09       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-06       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-23       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
M3YDI3_BCL2L11-01       --------VSSECDR-EGGQLQPVER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-02       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-01       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7CXT2_BCL2L11-01       --------LNSECDR-EGGQLQPTERPTQPQQLRP-G-----APTSIQTQ
O54918_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
O88498_BCL2L11-01       --------VNSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-24       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-08       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-03       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-06       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-04       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-18       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-01       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-16       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-12       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-06       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-08       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
A0A2K6GE31_BCL2L11      --------VGSECDR-EGGQLQSVER---PPQLRP-G-----APTSLQTE
A0A287DFJ0_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A286XJN2_BCL2L11      --------VSCECDR-EGGQLQPAER---PSQLRA-G-----APTSLQTE
A0A286XJN2_BCL2L11      --------VSCECDR-EGGQLQPAER---PSQLRA-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-07       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-05       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-02       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-09       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-21       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F7HHA9_BCL2L11-04       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-20       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5CAB2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
F6XMC1_BCL2L11-03       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6TRZ5_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6QIL2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5NU92_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5HZI7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5X2I7_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6E226_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K5Z8B6_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3M6I1_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2K6KJP8_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I2YQ13_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
O43521_BCL2L11-03       --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2I3HW02_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2R9CA99_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A2J8JCT2_BCL2L11      --------VSSECDR-EGRQLQPAER---PPQLRP-G-----APTSLQTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
A0A452FCS1_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
W5PY58_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
Q2YDF0_BCL2L11-02       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
F1SU81_BCL2L11-02       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
G1SSY0_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQSE
H0XW23_BCL2L11-01       --------VGSECDR-EGGQLQPAER---PPQLRP-G-----APTSLHTE
A0A337SW42_BCL2L11      --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
G1LDR8_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
J9NWV6_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
F1SU81_BCL2L11-01       --------VSSECDR-EGGQLQPAER---PPQLRP-G-----APTSLQTE
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       LV--------RWRDRSLLSTLMGGLLLPPSPCPFVTRSPFFIFMRRS---
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3P8RLE2_BCL2L11      RLNSTGGE-------------------PDSPSWSRAQASLGVFQTRS-IF
A0A3B1JXK6_BCL2L11      PGDGDPVRGP-----------------------PALHNSLLGYQTRSPLF
A0A3B4BVX1_BCL2L11      PGEGDPVRGG-----------------------ITMPNSLLGYQSRSPLF
A0A3B4BVX1_BCL2L11      PGEGDPVRGG-----------------------ITMPNSLLGYQSRSPLF
A0A3B4BVX1_BCL2L11      PGEGDPVRGG-----------------------ITMPNSLLGYQSRSPLF
A0A3P8XIA2_BCL2L11      EGNQQSRGGI-----------------------MMPTNSLLGFQSRSPLF
A0A3Q1ICY2_BCL2L11      FGRPDSSGGG-----------EPESQSRCRTKSSSSSDGLGVF--RS-VF
A0A3Q3K6I5_BCL2L11      FGHPGSAGGG-----------EPVSPSRCRTKAIAPLDSLSVFHTRS-IF
A0A3B4V919_BCL2L11      -----------------QRRAEPWPPRLHRRRRARLAAPVQNHSHLS-CQ
A0A3B4XZH1_BCL2L11      -----------------QRRAETIA--------TSPGNSLGVFQKRS-IF
A0A3Q3ESW6_BCL2L11      FGRTDSTGGG-----------EPDSPSRCRFKPVSPVDSLGVFQKRS-IF
A0A3Q2SZH6_BCL2L11      PGAVTAAGGGG-------GEPDSDSPPRS----IS-PNSLDVFQRRS-IF
A0A3B3VNE0_BCL2L11      TGASTAGGGGGGGGGG-GGEPDADSPPCS----VS-PASLDVFRSRS-IF
A0A3B3YII5_BCL2L11      AGASTAGGGGGGGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRS-IF
A0A3B3YII5_BCL2L11      AGASTAGGGGGGGGGG-RGEPDSDSPPCS----VS-PASLDVFRSRS-IF
A0A3P9N073_BCL2L11      AGASTAGGGGGGG----RGEPDSDSPPCT----VS-PASLDVFRSRS-IF
A0A3Q3B113_BCL2L11      RGRAPSAAGG-----------EPESPACS----SNPPAGLDVFRSRS-IF
A0A3B5M375_BCL2L11      AGASTAGGGGGGEGEGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IF
A0A3B5QAM1_BCL2L11      AGASTAGGGGGGEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IF
A0A3B5QAM1_BCL2L11      AGASTAGGGGGGEGGGRRGEPDSDSPPCS----VS-PASLDVFRSRS-IF
A0A3G3M2M0_BCL2L11      PL-------------------------RGGIAMSNSHQSRSPMSRTF---
A0A3Q1ELG4_BCL2L11      PD-------------------------SPSWSR--ASLGVFQTRSIF---
A0A3Q1CI15_BCL2L11      PD-------------------------SPSWSRAQASLGVFQTRSIF---
A0A3Q3SYA1_BCL2L11      SV--------------------------------------FHTRSIF---
B2KKY9_BCL2L11-01       -----EGDPLRGGISMSNNQSRSPM---------------------N---
B8JK68_BCL2L11-01       -----EGDPLRGGISMSNNQSRSPM---------------------N---
A0A3B3QC78_BCL2L11      PR--------------------------------------------F---
A0A3Q2U844_BCL2L11      ARPA----------------------SPGSPGPFAIRSPLFFFVRRS---
G3SU55_BCL2L11-01       PQGNPDG----EGDSCPQGSPQGPQAPPASPGPFATRSPLFIFVRRS---
G3W979_BCL2L11-01       YQGN-SG----EGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRS---
A0A3P8XIA2_BCL2L11      TS------------------------------------------------
K7GA86_BCL2L11-01       YQ------------------------------------------------
A0A3Q2GRS5_BCL2L11      QQ------------------------------------------------
Q4KMV9_BCL2L11-01       FQ----GNQSDEGGSSSASTPWGPTISPYSPSSFVNRSPHCMLVRGS---
F7FTC8_BCL2L11-01       YQ------------------------------------------------
A0A2K6E226_BCL2L11      P------------------------------GPFATRSP-----------
O43521_BCL2L11-11       PQ------------------------------------------------
F7HHA9_BCL2L11-08       PQ------------------------------------------------
O54918_BCL2L11-06       PQ------------------------------------------------
O54918_BCL2L11-08       PQ------------------------------------------------
O54918_BCL2L11-03       PQ------------------------------------------------
A0A2I3HW02_BCL2L11      PQ------------------------------------------------
A0A2K6TRZ5_BCL2L11      PQ------------------------------------------------
A0A2K5HZI7_BCL2L11      PQ------------------------------------------------
A0A2K5NU92_BCL2L11      PQ------------------------------------------------
A0A2K5Z8B6_BCL2L11      PQ------------------------------------------------
A0A2I2YQ13_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-15       PQ------------------------------------------------
A0A2R9CA99_BCL2L11      PQ------------------------------------------------
A0A2J8JCT2_BCL2L11      PQ------------------------------------------------
F7HHA9_BCL2L11-07       PQ------------------------------------------------
A0A2K5CAB2_BCL2L11      PQ------------------------------------------------
A0A2K5X2I7_BCL2L11      PQ------------------------------------------------
A0A2I3M6I1_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-07       PQ------------------------------------------------
O43521_BCL2L11-22       PQ------------------------------------------------
A0A452U4S4_BCL2L11      QQ------------------------------------------------
C1KGB8_BCL2L11-01       RQ------------------------------------------------
A0A2K6GE31_BCL2L11      PQ------------------------------------------------
A0A337SW42_BCL2L11      QQ------------------------------------------------
O43521_BCL2L11-17       PQ------------------------------------------------
O43521_BCL2L11-10       PQ------------------------------------------------
A0A2I2YQ13_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-19       PQ------------------------------------------------
O43521_BCL2L11-13       PQ------------------------------------------------
A0A2I3HW02_BCL2L11      PQ------------------------------------------------
A0A2R9CA99_BCL2L11      PQ------------------------------------------------
A0A2J8JCT2_BCL2L11      PQ------------------------------------------------
A0A2K5NU92_BCL2L11      PQ------------------------------------------------
A0A2K5X2I7_BCL2L11      PQ------------------------------------------------
F7HHA9_BCL2L11-05       PQ------------------------------------------------
A0A2K5Z8B6_BCL2L11      PQ------------------------------------------------
A0A2K5HZI7_BCL2L11      PQ------------------------------------------------
A0A2K6KJP8_BCL2L11      PQ------------------------------------------------
A0A2K6QIL2_BCL2L11      PQ------------------------------------------------
O54918_BCL2L11-05       PQ------------------------------------------------
O88498_BCL2L11-02       SQ------------------------------------------------
A0A0D9RWE0_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-05       PQ------------------------------------------------
O43521_BCL2L11-25       PQ------------------------------------------------
F1SU81_BCL2L11-03       RQ------------------------------------------------
A0A2K6GE31_BCL2L11      PQ------------------------------------------------
A0A286XJN2_BCL2L11      PQ------------------------------------------------
A0A2K5CAB2_BCL2L11      PQ------------------------------------------------
A0A2K6TRZ5_BCL2L11      PQ------------------------------------------------
A0A2K6QIL2_BCL2L11      PQ------------------------------------------------
A0A2K5NU92_BCL2L11      PQ------------------------------------------------
A0A2K5HZI7_BCL2L11      PQ------------------------------------------------
A0A2K5X2I7_BCL2L11      PQ------------------------------------------------
A0A2K6E226_BCL2L11      PQ------------------------------------------------
A0A2K5Z8B6_BCL2L11      PQ------------------------------------------------
A0A2I3M6I1_BCL2L11      PQ------------------------------------------------
A0A2I3M6I1_BCL2L11      PQ------------------------------------------------
A0A2K6KJP8_BCL2L11      PQ------------------------------------------------
A0A2I2YQ13_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-02       PQ------------------------------------------------
A0A2R9CA99_BCL2L11      PQ------------------------------------------------
A0A2J8JCT2_BCL2L11      PQ------------------------------------------------
H2P5E2_BCL2L11-01       PQ------------------------------------------------
A0A337SW42_BCL2L11      QQ------------------------------------------------
A0A452SBG5_BCL2L11      QQ------------------------------------------------
Q2YDF0_BCL2L11-01       RQ------------------------------------------------
A0A287DFJ0_BCL2L11      PQ------------------------------------------------
Q2YDF0_BCL2L11-03       RQ------------------------------------------------
A0A452FCS1_BCL2L11      RQ------------------------------------------------
A0A2K5CAB2_BCL2L11      PQ------------------------------------------------
A0A2K5Z8B6_BCL2L11      PQ------------------------------------------------
A0A2K6KJP8_BCL2L11      PQ------------------------------------------------
A0A2K6QIL2_BCL2L11      PQ------------------------------------------------
F6XMC1_BCL2L11-09       PQ------------------------------------------------
A0A2K6TRZ5_BCL2L11      PQ------------------------------------------------
A0A2K5HZI7_BCL2L11      PQ------------------------------------------------
A0A2R9CA99_BCL2L11      PQ------------------------------------------------
A0A2J8JCT2_BCL2L11      PQ------------------------------------------------
A0A2K5NU92_BCL2L11      PQ------------------------------------------------
A0A2K5X2I7_BCL2L11      PQ------------------------------------------------
F7HHA9_BCL2L11-09       PQ------------------------------------------------
A0A2K6E226_BCL2L11      PQ------------------------------------------------
A0A2I3M6I1_BCL2L11      PQ------------------------------------------------
A0A2I2YQ13_BCL2L11      PQ------------------------------------------------
O43521_BCL2L11-06       PQ------------------------------------------------
O43521_BCL2L11-23       PQ------------------------------------------------
A0A2I3HW02_BCL2L11      PQ------------------------------------------------
M3YDI3_BCL2L11-01       QQ------------------------------------------------
F6XMC1_BCL2L11-02       PQ------------------------------------------------
F6XMC1_BCL2L11-01       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F7CXT2_BCL2L11-01       YQGNS-----GEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFLRRS---
O54918_BCL2L11-01       PQGNPDG----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
O88498_BCL2L11-01       SQGNPDG----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A337SW42_BCL2L11      QQGNPE----GEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRS---
A0A337SW42_BCL2L11      QQGNPE----GEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-24       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-08       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
F7HHA9_BCL2L11-03       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3HW02_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-06       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-04       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-18       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
F7HHA9_BCL2L11-01       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3HW02_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-16       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-12       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
F7HHA9_BCL2L11-06       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3HW02_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-08       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6GE31_BCL2L11      PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A287DFJ0_BCL2L11      PQGNPEG----EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A286XJN2_BCL2L11      PQGNPEG----AGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A286XJN2_BCL2L11      PQGNPEG----AGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-07       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-05       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
F7HHA9_BCL2L11-02       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-09       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-21       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
F7HHA9_BCL2L11-04       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-20       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3HW02_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K5CAB2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F6XMC1_BCL2L11-03       PQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6TRZ5_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6QIL2_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5NU92_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5HZI7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5X2I7_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6E226_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K5Z8B6_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3M6I1_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2K6KJP8_BCL2L11      PQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I2YQ13_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
O43521_BCL2L11-03       PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2I3HW02_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2R9CA99_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A2J8JCT2_BCL2L11      PQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS---
A0A337SW42_BCL2L11      QQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRS---
A0A452FCS1_BCL2L11      RQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
W5PY58_BCL2L11-01       RQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
Q2YDF0_BCL2L11-02       RQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F1SU81_BCL2L11-02       RQGNPEG----EGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRS---
G1SSY0_BCL2L11-01       PQGNP------EGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRS---
H0XW23_BCL2L11-01       PQGNPEGNPEVEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
A0A337SW42_BCL2L11      QQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVRRS---
G1LDR8_BCL2L11-01       QQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
J9NWV6_BCL2L11-01       QQGNPEG----EGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRS---
F1SU81_BCL2L11-01       RQGNPEG----EGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRS---
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       ------------------------------LLCA----------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       LVLSTSSSGYFTFD-SDIVH----SPAP--VSVH--------------KA
R4G9R5_BCL2L11-01       NVLSANAFAISCFLYRDV------------------------------PW
A0A3P8RLE2_BCL2L11      HLPRRSSSGYFSADGADSVPSSPLSPKR--LTAD--------------KA
A0A3B1JXK6_BCL2L11      RTLSRSSSGYFSFD-SE--PSSPL------LMHS--------------AS
A0A3B4BVX1_BCL2L11      RTLSRSSSGYFSFE-SE--PSSPL------VTHS--------------AS
A0A3B4BVX1_BCL2L11      RTLSRSSSGYFSFE-SE--PSSPL------LT------------------
A0A3B4BVX1_BCL2L11      RTLSRSSSGYFSFE-SE--PSSPL------VTHS--------------AS
A0A3P8XIA2_BCL2L11      RTTSTSSSGYFSFD-CDSIPSSPL------LRNN--------------KS
A0A3Q1ICY2_BCL2L11      RLPRRSSSGYFSYD-SDSQPSSPLSPRP--VTFD--------------RA
A0A3Q3K6I5_BCL2L11      HLPRRSSSGYFSND-SDSVPSSPLSPRP--VTAD--------------KV
A0A3B4V919_BCL2L11      HFSRRSSSGYFSFD-SDSLPSSPLSPRP--ATVE--------------RT
A0A3B4XZH1_BCL2L11      SYPRRSSSGYFSFD-SDSLPTSPLSPRP--ATAE--------------RT
A0A3Q3ESW6_BCL2L11      HLPRRASSGYFSYD-GDSLPSSPLSPRP--LTAD--------------KA
A0A3Q2SZH6_BCL2L11      ----RKSSGYFSFD-CESLPSTPLSPHP--LTAD--------------KA
A0A3B3VNE0_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3B3YII5_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3B3YII5_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3P9N073_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KT
A0A3Q3B113_BCL2L11      RFPRRSSSGYFSFE-GDSLPSSPLSPKP--VTAE--------------KA
A0A3B5M375_BCL2L11      RPTRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3B5QAM1_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3B5QAM1_BCL2L11      RPPRRSSSGYFSFD-CDSLPSSPLSPHP--VTAD--------------KA
A0A3G3M2M0_BCL2L11      S---RSSSGYFSVD-SDSVPGSPLLPNI--SEAQDDQNDEVWFAEPSHQH
A0A3Q1ELG4_BCL2L11      HLPRRSSSGYFSADGSDSVPSSPLSPKR--LTAD--------------KT
A0A3Q1CI15_BCL2L11      HLPRRSSSGYFSADGADSVPSSPLSPKR--LTAD--------------KA
A0A3Q3SYA1_BCL2L11      QLPRRSSSGYFSSD-GDSLPSSPLSPRP--VTAD--------------KA
B2KKY9_BCL2L11-01       RTFSRSSSGYFSVD-SDS------VPGSPLM------------------P
B8JK68_BCL2L11-01       RTFSRSSSGYFSVD-SDS------VPGSPLM------------------P
A0A3B3QC78_BCL2L11      STLSASSSGYHSLD-ISL------PNSP-FMTHN--------------KS
A0A3Q2U844_BCL2L11      PLLPRSSSGYFSFE-AER------SPAP--MSCD--------------KA
G3SU55_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
G3W979_BCL2L11-01       PLLPRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A3P8XIA2_BCL2L11      ------SSGYFSFD-CDS------IPSSPLLRNN--------------KS
K7GA86_BCL2L11-01       ----------------DR------SPVP--MSCD--------------KS
A0A3Q2GRS5_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
Q4KMV9_BCL2L11-01       SLVSKTSSGYFSF---EV------SPGP--VSCD--------------KS
F7FTC8_BCL2L11-01       ----------------DR------SPPP--VSCD--------------KS
A0A2K6E226_BCL2L11      --------------------------------CD--------------KS
O43521_BCL2L11-11       ------------------------------------------------VS
F7HHA9_BCL2L11-08       ------------------------------------------------VS
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-03       ----------------DR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-15       ----------------DR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-07       ----------------DR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-07       ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-22       ----------------DR------SPAP--MSCD--------------KS
A0A452U4S4_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       ----------------DR------SPAP--MSCD--------------KS
O88498_BCL2L11-02       ----------------DR------SPAP--MSCD--------------KS
A0A0D9RWE0_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-05       ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-25       ----------------DR------SPAP--MSCD--------------KS
F1SU81_BCL2L11-03       ----------------DR------SPAP--MSCD--------------KS
A0A2K6GE31_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A286XJN2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-02       ----------------DR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
H2P5E2_BCL2L11-01       ----------------DR------SPAP--MSCD--------------KS
A0A337SW42_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A452SBG5_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
Q2YDF0_BCL2L11-01       ----------------DR------SPAP--MSCD--------------KS
A0A287DFJ0_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
Q2YDF0_BCL2L11-03       ----------------DR------SPAP--MSCD--------------KS
A0A452FCS1_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-09       ----------------DR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-09       ----------------DR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-06       ----------------DR------SPAP--MSCD--------------KS
O43521_BCL2L11-23       ----------------DR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      ----------------DR------SPAP--MSCD--------------KS
M3YDI3_BCL2L11-01       ----------------DR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-02       ----------------DR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-01       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7CXT2_BCL2L11-01       PLLPRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O54918_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O88498_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A337SW42_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A337SW42_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-24       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-08       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-03       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-06       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-04       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-18       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-16       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-12       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-06       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6GE31_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6GE31_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-08       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6GE31_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6GE31_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A287DFJ0_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A286XJN2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A286XJN2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-07       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-05       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-02       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-09       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-21       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F7HHA9_BCL2L11-04       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-20       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5CAB2_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F6XMC1_BCL2L11-03       SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6TRZ5_BCL2L11      SVLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6QIL2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5NU92_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5HZI7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5X2I7_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6E226_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K5Z8B6_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3M6I1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2K6KJP8_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I2YQ13_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
O43521_BCL2L11-03       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2I3HW02_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2R9CA99_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A2J8JCT2_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A337SW42_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A452FCS1_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
W5PY58_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
Q2YDF0_BCL2L11-02       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F1SU81_BCL2L11-02       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
G1SSY0_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
H0XW23_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
A0A337SW42_BCL2L11      SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
G1LDR8_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
J9NWV6_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
F1SU81_BCL2L11-01       SLLSRSSSGYFSFD-TDR------SPAP--MSCD--------------KS
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       -----------------------ASRWRSH--------------------
G1PDJ5_BCL2L11-01       ------------------------SMQQSQ--------------------
M3XHJ5_BCL2L11-01       TQTPSPSSQLIVHVQHCL-----AQREQHPETHG----------------
R4G9R5_BCL2L11-01       RRTGRRWCEAETSRWQSR--------------------------------
A0A3P8RLE2_BCL2L11      TQTPSPSGQVIKHALERM--------------------------------
A0A3B1JXK6_BCL2L11      TQTPSPSSQVIIHALQRI-----SEARGDAQSFELCPGPNHCPPHRA---
A0A3B4BVX1_BCL2L11      TQTPSPSSQVITHALQRI-----AEARGNAQTFELWPLYNHHPPHGA---
A0A3B4BVX1_BCL2L11      ----SPSLSVCST--------------------ELWPLYNHHPPHGA---
A0A3B4BVX1_BCL2L11      TQTPSPSSQVITHALQRI-----AEARGNAQTFELWPLYNHHPPHGA---
A0A3P8XIA2_BCL2L11      TQTPSPSSQVITHAMRRL-----SKPQDTWRG---YEAWPTPHHPYRPRP
A0A3Q1ICY2_BCL2L11      TQTPSPTGQVMNHALQRL-----AEANGSDLR-T-HQQHGSDLSSSSTQQ
A0A3Q3K6I5_BCL2L11      TQTPSPSSQVMNHALQCM-----AEAHGGRPG-T-HRQDASSPSPSSARQ
A0A3B4V919_BCL2L11      TQTPSPTSQVMKHALQRM-----AEAHGGGAR-MQQQH------------
A0A3B4XZH1_BCL2L11      TQTPSPTSQVMKHALQRM-----AEAHGGGAR-MQQQQHGEHRH------
A0A3Q3ESW6_BCL2L11      TQTPSPSGQVMQHALQRM-----TEAHGGGPG-T-QQQYGHSPSLTSRRQ
A0A3Q2SZH6_BCL2L11      TQTASPTGQVMNHALQRM-----AAEHGGQPA-RILGLHGHSFSARQG--
A0A3B3VNE0_BCL2L11      TQTPSPTGQVMNHALQRM-----AVEHGG------LGLHGHSPNHYSTI-
A0A3B3YII5_BCL2L11      TQTPSPTGQVMNHALQRM-----AVEHGG------LGLHGHSPNHYSTI-
A0A3B3YII5_BCL2L11      TQTPSPTGQVMNHALQRM-----AVEHGG------LGLHGHSPNHYSTI-
A0A3P9N073_BCL2L11      TQTPSPTGQVMNHALQRM-----AVEHEIPKL-N-VKGKEEKGGRGGAFV
A0A3Q3B113_BCL2L11      TQTPSPTGQVMNHALQRM-----AVEQGGGPG-T-HRLHGSSPNPSGTQA
A0A3B5M375_BCL2L11      TQTPSLTGQVMNHALQRM-----AVEHGG------LGLQGEQT---SVL-
A0A3B5QAM1_BCL2L11      TQTPSLTGQVMNHALQRM-----AVEHGG------LGLHGQSPNHYSTI-
A0A3B5QAM1_BCL2L11      TQTPSLTGQVMNHALQRM-----AVEHGG------LGLHGQSPNHYSTI-
A0A3G3M2M0_BCL2L11      VQMAAPVGAMG---------------------------------------
A0A3Q1ELG4_BCL2L11      TQTPSPSGQV----------------------------------------
A0A3Q1CI15_BCL2L11      TQTPSPSGQV----------------------------------------
A0A3Q3SYA1_BCL2L11      TQTPSLTSQVMNHALQRL-----AEAHGGG--------------------
B2KKY9_BCL2L11-01       NISEAQDGQNDEVWLSEH-----SHQHLQM--------------------
B8JK68_BCL2L11-01       NISEAQDGQNDEVWLSEH-----SHQHLQM--------------------
A0A3B3QC78_BCL2L11      TQTPSPSNHLVCIYLSSV--------TRTL--------------------
A0A3Q2U844_BCL2L11      TQTPSPPCQAVSHYLSAM-----ASRWRSH--------------------
G3SU55_BCL2L11-01       TQTPSPPCQAINHYLSAM-----ASMRQSQ--------------------
G3W979_BCL2L11-01       TQTPSPPCQAFNHYLSAMDT---ASMRQSQ--------------------
A0A3P8XIA2_BCL2L11      TQTPSPSSQVITHAMR----------------------------------
K7GA86_BCL2L11-01       TQTPSPPCQAFNHYLSAMGKQDHASRWESP--------------------
A0A3Q2GRS5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
Q4KMV9_BCL2L11-01       TQTPSPPCQAFNHLLSAM-----ADRN-----------------------
F7FTC8_BCL2L11-01       TQTPSPHCQAFNHYLSAM-----ASIRQPQ--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
O43521_BCL2L11-11       LCHPGWSALVRSWLTATS-----NSQVQAV--------------------
F7HHA9_BCL2L11-08       LCCPSWSALVLSWLTATS-----NSQVQAV--------------------
O54918_BCL2L11-06       -----------------------ASIRQSQ--------------------
O54918_BCL2L11-08       -----------------------ASIRQSQ--------------------
O54918_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----DQLENLN--------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEAAGSS--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----DDSAGSS--------------------
O43521_BCL2L11-15       TQTPSPPCQAFNHYLSAM-----DDSAGSS--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----DDSAGSS--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----DDSAGSS--------------------
F7HHA9_BCL2L11-07       TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATESS--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----DEATGSS--------------------
O43521_BCL2L11-07       TQTPSPPCQAFNHYLSAM---------VRE--------------------
O43521_BCL2L11-22       TQTPSPPCQAFNHYLSAM---------VRE--------------------
A0A452U4S4_BCL2L11      TQTPSPPCQAFNHYLSAM-----DLWTVER--------------------
C1KGB8_BCL2L11-01       -----------------------ASMRQSQ--------------------
A0A2K6GE31_BCL2L11      -----------------------ASMRQFQ--------------------
A0A337SW42_BCL2L11      -----------------------ASMRQPQ--------------------
O43521_BCL2L11-17       -----------------------ASMRQAE--------------------
O43521_BCL2L11-10       -----------------------ASMRQAE--------------------
A0A2I2YQ13_BCL2L11      -----------------------ASMRQAE--------------------
O43521_BCL2L11-19       -----------------------ASMRQAE--------------------
O43521_BCL2L11-13       -----------------------ASMRQAE--------------------
A0A2I3HW02_BCL2L11      -----------------------ASMRQAE--------------------
A0A2R9CA99_BCL2L11      -----------------------ASMRQAE--------------------
A0A2J8JCT2_BCL2L11      -----------------------ASMRQAE--------------------
A0A2K5NU92_BCL2L11      -----------------------ASRRQAE--------------------
A0A2K5X2I7_BCL2L11      -----------------------ASRRQAE--------------------
F7HHA9_BCL2L11-05       -----------------------ASRRQAE--------------------
A0A2K5Z8B6_BCL2L11      -----------------------ASRRQAE--------------------
A0A2K5HZI7_BCL2L11      -----------------------ASRRQAE--------------------
A0A2K6KJP8_BCL2L11      -----------------------ASRRQAE--------------------
A0A2K6QIL2_BCL2L11      -----------------------ASRRQAE--------------------
O54918_BCL2L11-05       TQTPSPPCQAFNHYLSAM-----ASIRQSQ--------------------
O88498_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASIRQSQ--------------------
A0A0D9RWE0_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
O43521_BCL2L11-05       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-25       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
F1SU81_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6GE31_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQFQ--------------------
A0A286XJN2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
H2P5E2_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A337SW42_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQPQ--------------------
A0A452SBG5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
Q2YDF0_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A287DFJ0_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRESQ--------------------
Q2YDF0_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A452FCS1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM--------------------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
F6XMC1_BCL2L11-09       TQTPSPPCQAFNHYLSAM-----VVIRMDI--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVIRMDI--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
F7HHA9_BCL2L11-09       TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
O43521_BCL2L11-06       TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
O43521_BCL2L11-23       TQTPSPPCQAFNHYLSAM-----VVILEDI--------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----VVILEDV--------------------
M3YDI3_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASRRQSQ--------------------
F6XMC1_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F6XMC1_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F7CXT2_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
O54918_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASIRQSQ--------------------
O88498_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASIRQSQ--------------------
A0A337SW42_BCL2L11      TQTPSPPCQAFNHYLSAM--------------------------------
A0A337SW42_BCL2L11      TQTPSPPCQAFNHYLSAM-----VRAI-----------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
O43521_BCL2L11-24       TQTPSPPCQAFNHYLSAM-----VREI-----------------------
O43521_BCL2L11-08       TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
F7HHA9_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
F6XMC1_BCL2L11-06       TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ADWD-----------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ADWD-----------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
F6XMC1_BCL2L11-04       TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
O43521_BCL2L11-18       TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
F7HHA9_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----GIFE-----------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
O43521_BCL2L11-16       TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
O43521_BCL2L11-12       TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
F7HHA9_BCL2L11-06       TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ANWD-----------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----GVFE-----------------------
A0A2K6GE31_BCL2L11      TQTPSPPCQAFNHYLSAM-----VREI-----------------------
A0A2K6GE31_BCL2L11      TQTPSPPCQAFNHYLSAM--------------------------------
F6XMC1_BCL2L11-08       TQTPSPPCQAFNHYLSAM-----GYRLTGQ--------------------
A0A2K6GE31_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQFQ--------------------
A0A2K6GE31_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQFQ--------------------
A0A287DFJ0_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRESQ--------------------
A0A286XJN2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A286XJN2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F6XMC1_BCL2L11-07       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F6XMC1_BCL2L11-05       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
F7HHA9_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-09       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-21       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
F7HHA9_BCL2L11-04       TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-20       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K5CAB2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F6XMC1_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6TRZ5_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6QIL2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5NU92_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5HZI7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5X2I7_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6E226_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K5Z8B6_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I3M6I1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2K6KJP8_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASRR--Q--------------------
A0A2I2YQ13_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
O43521_BCL2L11-03       TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2I3HW02_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2R9CA99_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A2J8JCT2_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMR--Q--------------------
A0A337SW42_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQPQ--------------------
A0A452FCS1_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
W5PY58_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
Q2YDF0_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F1SU81_BCL2L11-02       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
G1SSY0_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
H0XW23_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
A0A337SW42_BCL2L11      TQTPSPPCQAFNHYLSAM-----ASMRQPQ--------------------
G1LDR8_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
J9NWV6_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
F1SU81_BCL2L11-01       TQTPSPPCQAFNHYLSAM-----ASMRQSQ--------------------
                                                                          

Q6JTU4_BCL2L11-01       ----------EIWIAQELRRIGDEFNA-Y--------------------Y
G1MV54_BCL2L11-01       -SLAEEIQ-PEIWIAQELRRIGDEFNASY--------------------C
G1PDJ5_BCL2L11-01       -ALPVDMR-PEMWIAQELRRIGDEFNNSYR-------------------N
M3XHJ5_BCL2L11-01       -KNPLNFT------------------------------------------
R4G9R5_BCL2L11-01       -PIPEDMQ-PEIWIAQELRRIGDEFNASH--------------------C
A0A3P8RLE2_BCL2L11      -TDEAHGGGPGTQQHGELRLT----------------------------Y
A0A3B1JXK6_BCL2L11      -AAAGDMQ-AHWYIAQELRRIGDEFNDLY--------------------F
A0A3B4BVX1_BCL2L11      -APAGDMR-PESYVAQELRRIGDEFNELY--------------------F
A0A3B4BVX1_BCL2L11      -APAGDMR-PESYVAQELRRIGDEFNELY--------------------F
A0A3B4BVX1_BCL2L11      -APAGDMR-PESYVAQELRRIGDEFNELY--------------------F
A0A3P8XIA2_BCL2L11      PPIAGDMR-PEILIGQELQRIGDEFNNLF--------------------I
A0A3Q1ICY2_BCL2L11      QNAAGDMQ-AVEV-GRELRRIGDDFNNHL--------------------L
A0A3Q3K6I5_BCL2L11      QNAIRDMQ-AEAV-GRELRRIGDDYNNHL--------------------L
A0A3B4V919_BCL2L11      ----------------------GELKPAL--------------------L
A0A3B4XZH1_BCL2L11      -FASGDMQ-AEAV-GQELRRIGDDFNRLL--------------------L
A0A3Q3ESW6_BCL2L11      RTAAGDMQ-AEAI-GRDLQRIGDDYNRLL--------------------L
A0A3Q2SZH6_BCL2L11      -NAARDMQ-PERF-GRQLRAIGDEYNNHL--------------------M
A0A3B3VNE0_BCL2L11      -NAARDMQ-SETF-GRQLRAIGDDYNNHL--------------------M
A0A3B3YII5_BCL2L11      -NAARDMQ-SENF-GRQLRAIGDDYNNHL--------------------M
A0A3B3YII5_BCL2L11      -NAARDMQ-SENF-GRQLRAIGDDYNNHL--------------------M
A0A3P9N073_BCL2L11      IIPKRETN-QPIL-SC----------------------------------
A0A3Q3B113_BCL2L11      RNAAGDME-AESF-GRHLRTIGDEYNRLL--------------------L
A0A3B5M375_BCL2L11      -PPPPSET-STTW-EQ----------------------------------
A0A3B5QAM1_BCL2L11      -NAARDMQ-SETY-GRQLRAIGDEYNNLL--------------------M
A0A3B5QAM1_BCL2L11      -NAARDMQ-SETY-GRQLRAIGDEYNNLL--------------------M
A0A3G3M2M0_BCL2L11      ---------PEISVARELRRIGDEFNRLYCQGAGAGGNNRAQL---HAPN
A0A3Q1ELG4_BCL2L11      -------------IRHALERMAGEAHR---GGPETQRQQHGELNDCRSCG
A0A3Q1CI15_BCL2L11      -------------IKHALERMTDEAHG---GGPGT--QQHGEL---RLTY
A0A3Q3SYA1_BCL2L11      -AGAHRQHGEHKHLRSRLFTAHAEYTQVKQP-------------------
B2KKY9_BCL2L11-01       -AAPVAALPPEMVVARELRRIGDEFNRLYCE------------------A
B8JK68_BCL2L11-01       -AAPVAALPPEMVVARELRRIGDEFNRLYCE------------------A
A0A3B3QC78_BCL2L11      -SMLPDMR-PEMLVARELRRIGDKFNDIYINGVSILLCPHCPLR--PTAM
A0A3Q2U844_BCL2L11      -SLAEEIQ-PEIWIAQELRRIGDEFNASY--------------------C
G3SU55_BCL2L11-01       -ALPADLR-PEIWIARELRRIGDEFNAYY---------------------
G3W979_BCL2L11-01       -SIPADMR-PEIWIAQELRRIGDEFNASY---------------------
A0A3P8XIA2_BCL2L11      ---PGDMR-PEILIGQELQRIGDEFNN-L--------------------F
K7GA86_BCL2L11-01       -SIREDMQ-PEIWIAQELRRIGDEFNASY--------------------C
A0A3Q2GRS5_BCL2L11      -AVPADMR-PEVWIAQELRRIGDEFNA-S--------------------Y
Q4KMV9_BCL2L11-01       ---PVNQMSPELWIAQELRRIGDDFNASF--------------------S
F7FTC8_BCL2L11-01       -SVPEDMR-PEIWIAQELRRIGDEFNASY--------------------C
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-11       -LLPQPPK------------------------------------------
F7HHA9_BCL2L11-08       -LLPQPPK------------------------------------------
O54918_BCL2L11-06       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
O54918_BCL2L11-08       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
O54918_BCL2L11-03       -QVAQNIH-GDAWYN-----------------------------------
A0A2I3HW02_BCL2L11      -L-------EVQWPFEWLAKSS----------------------------
A0A2K6TRZ5_BCL2L11      -L--ALRR-EVQCPLEWLAKSS----------------------------
A0A2K5HZI7_BCL2L11      -LRIALHR-EVQ--------------------------------------
A0A2K5NU92_BCL2L11      -LRIALHR-EVQWPLECLASS-----------------------------
A0A2K5Z8B6_BCL2L11      -LGIALHR-EVQWPLECLASS-----------------------------
A0A2I2YQ13_BCL2L11      -LRIALHR-EVQWPLEWLAKSS----------------------------
O43521_BCL2L11-15       -LRIALHR-EVQWPLKWLAKSS----------------------------
A0A2R9CA99_BCL2L11      -LRIALHR-EVQWPLKWLAKSS----------------------------
A0A2J8JCT2_BCL2L11      -LRIALHR-EVQWPLKWLAKSS----------------------------
F7HHA9_BCL2L11-07       -LGIALHR-EVQWPLEWLA-------------------------------
A0A2K5CAB2_BCL2L11      -LGIALRR-EVQWPLEWLAKSS----------------------------
A0A2K5X2I7_BCL2L11      -LGIALHR-EVQWPLEWLASS-----------------------------
A0A2I3M6I1_BCL2L11      -LGIALHR-EVQWPLEWLASS-----------------------------
O43521_BCL2L11-07       -IEEVVV-------------------------------------------
O43521_BCL2L11-22       -IEEVVV-------------------------------------------
A0A452U4S4_BCL2L11      -HLETAL-------------------------------------------
C1KGB8_BCL2L11-01       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6GE31_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A337SW42_BCL2L11      -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-17       ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-10       ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2I2YQ13_BCL2L11      ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-19       ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-13       ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2I3HW02_BCL2L11      ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2R9CA99_BCL2L11      ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2J8JCT2_BCL2L11      ---PADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5NU92_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5X2I7_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
F7HHA9_BCL2L11-05       ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5Z8B6_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5HZI7_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      ---PADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
O54918_BCL2L11-05       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
O88498_BCL2L11-02       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
A0A0D9RWE0_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-05       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-25       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F1SU81_BCL2L11-03       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6GE31_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A286XJN2_BCL2L11      -AGPPHLR-PEIWIAQELRRIGDEFNA-S--------------------Y
A0A2K5CAB2_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6TRZ5_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5NU92_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5HZI7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5X2I7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5Z8B6_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I3M6I1_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I3M6I1_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I2YQ13_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-02       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2R9CA99_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2J8JCT2_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
H2P5E2_BCL2L11-01       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A337SW42_BCL2L11      -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A452SBG5_BCL2L11      -DVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
Q2YDF0_BCL2L11-01       -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A287DFJ0_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNL-Y--------------------Y
Q2YDF0_BCL2L11-03       -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A452FCS1_BCL2L11      -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5CAB2_BCL2L11      -GDISLWF-RFIFTFFDL-------------------------------Y
A0A2K5Z8B6_BCL2L11      -GDSSL-F-GFIFTGLDL-------------------------------Y
A0A2K6KJP8_BCL2L11      -GDTSLWF-GFIFTGLDL-------------------------------Y
A0A2K6QIL2_BCL2L11      -GDTSLWF-GFIFTGLDL-------------------------------Y
F6XMC1_BCL2L11-09       -GDISLWF-RFTFTFFDL-------------------------------C
A0A2K6TRZ5_BCL2L11      -GDISLWF-RFIFTFFDL-------------------------------Y
A0A2K5HZI7_BCL2L11      -GDTSLWF-GFIFTGLDL-------------------------------Y
A0A2R9CA99_BCL2L11      -GDLSLCF-GFIFTGLDL-------------------------------Y
A0A2J8JCT2_BCL2L11      -GDLSLCF-GFIFTGLDL-------------------------------Y
A0A2K5NU92_BCL2L11      -GDSSLWF-GFIFTGLDL-------------------------------Y
A0A2K5X2I7_BCL2L11      -GDSSLWF-GFIFTGLDL-------------------------------Y
F7HHA9_BCL2L11-09       -GDSSLWF-GFIFTGLDL-------------------------------Y
A0A2K6E226_BCL2L11      -GDSSLWF-GFIFTGLDL-------------------------------Y
A0A2I3M6I1_BCL2L11      -GDSSLWF-GFIFTGLDL-------------------------------Y
A0A2I2YQ13_BCL2L11      -GDLSLWF-GFIFTGLDL-------------------------------Y
O43521_BCL2L11-06       -GDLSLCF-GFIFTGLDL-------------------------------Y
O43521_BCL2L11-23       -GDLSLCF-GFIFTGLDL-------------------------------Y
A0A2I3HW02_BCL2L11      -GDISLWF-GFIFTGLDL-------------------------------Y
M3YDI3_BCL2L11-01       -AVPADMR-PEMWIAQELRRIGDEFNA-Y--------------------Y
F6XMC1_BCL2L11-02       -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F6XMC1_BCL2L11-01       -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F7CXT2_BCL2L11-01       -SIPADMR-PEIWIAQELRRIGDEFNASY--------------------Y
O54918_BCL2L11-01       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
O88498_BCL2L11-01       -EEPEDLR-PEIRIAQELRRIGDEFNE-T--------------------Y
A0A337SW42_BCL2L11      -----------GLFE-----------------------------------
A0A337SW42_BCL2L11      ---------EEGVL------------------------------------
A0A2K5NU92_BCL2L11      ---------EEVVV------------------------------------
A0A2K5HZI7_BCL2L11      ---------EEVVV------------------------------------
A0A2I2YQ13_BCL2L11      ---------EEVVV------------------------------------
O43521_BCL2L11-24       ---------EEVVV------------------------------------
O43521_BCL2L11-08       ---------EEVVV------------------------------------
A0A2K5X2I7_BCL2L11      ---------EEVVV------------------------------------
F7HHA9_BCL2L11-03       ---------EEVVV------------------------------------
A0A2K6E226_BCL2L11      ---------EEVVV------------------------------------
A0A2K5Z8B6_BCL2L11      ---------EEVVV------------------------------------
A0A2I3HW02_BCL2L11      ---------EEVVV------------------------------------
A0A2R9CA99_BCL2L11      ---------EEVVV------------------------------------
A0A2J8JCT2_BCL2L11      ---------EEVVV------------------------------------
A0A2I3M6I1_BCL2L11      ---------EEVVV------------------------------------
A0A2K6KJP8_BCL2L11      ---------EEVVV------------------------------------
A0A2K6QIL2_BCL2L11      ---------EEVVV------------------------------------
A0A2K5CAB2_BCL2L11      ---------EEVVV------------------------------------
F6XMC1_BCL2L11-06       ---------EEVVV------------------------------------
A0A2K6TRZ5_BCL2L11      ---------EEVVV------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      ---------EEVVV------------------------------------
A0A2K6GE31_BCL2L11      ----------GIFE------------------------------------
F6XMC1_BCL2L11-08       -QPCLPWKVRGIGEKQEERVNPHTWET-F--------------------K
A0A2K6GE31_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6GE31_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A287DFJ0_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNL-Y--------------------Y
A0A286XJN2_BCL2L11      -AGPPHLR-PEIWIAQELRRIGDEFNA-S--------------------Y
A0A286XJN2_BCL2L11      -AGPPHLR-PEIWIAQELRRIGDEFNA-S--------------------Y
A0A2K5CAB2_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F6XMC1_BCL2L11-07       -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6TRZ5_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F6XMC1_BCL2L11-05       -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6TRZ5_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5CAB2_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5NU92_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5HZI7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5X2I7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
F7HHA9_BCL2L11-02       -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5Z8B6_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I3M6I1_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I2YQ13_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-09       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-21       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2R9CA99_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2J8JCT2_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5NU92_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5HZI7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5X2I7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
F7HHA9_BCL2L11-04       -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5Z8B6_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I3M6I1_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I2YQ13_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-20       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2I3HW02_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2R9CA99_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2J8JCT2_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5CAB2_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K5CAB2_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F6XMC1_BCL2L11-03       -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6TRZ5_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6TRZ5_BCL2L11      -AEPAGMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6QIL2_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5NU92_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5HZI7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5X2I7_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6E226_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K5Z8B6_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I3M6I1_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2K6KJP8_BCL2L11      -AEPADMR-PEIRIAQELRRIGDEFNA-Y--------------------Y
A0A2I2YQ13_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
O43521_BCL2L11-03       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2I3HW02_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2R9CA99_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A2J8JCT2_BCL2L11      -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A337SW42_BCL2L11      -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
A0A452FCS1_BCL2L11      -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
W5PY58_BCL2L11-01       -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
Q2YDF0_BCL2L11-02       -AVPADTR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F1SU81_BCL2L11-02       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
G1SSY0_BCL2L11-01       -AEPADTR-PETWIAQELRRIGDEFNA-Y--------------------Y
H0XW23_BCL2L11-01       -AEPADLR-PEMWIAQELRRIGDEFNA-Y--------------------Y
A0A337SW42_BCL2L11      -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
G1LDR8_BCL2L11-01       -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
J9NWV6_BCL2L11-01       -AVPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
F1SU81_BCL2L11-01       -AEPADMR-PEIWIAQELRRIGDEFNA-Y--------------------Y
                                                                          

Q6JTU4_BCL2L11-01       ARRLEK--------------------------------------------
G1MV54_BCL2L11-01       PRRGFLDNH---AGN---PQVVILRLLH-----------------YIIRL
G1PDJ5_BCL2L11-01       PRRDFLNVYREAEGH---PQMVVLRLLR-----------------YILRL
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       PRRGFLDYQAVN------HQIIILRLLH-----------------YIVRF
A0A3P8RLE2_BCL2L11      TREISCTFNLCNSFCTLFSVTVFCHLQSLFASTLQNVLIRFINPNYFSTF
A0A3B1JXK6_BCL2L11      ------RGAGR-NGGGAQLPAQNEPAFI-----------------LWMGL
A0A3B4BVX1_BCL2L11      ------HGVSQLHGCVAGMQALSNPVAF-----------------SILGL
A0A3B4BVX1_BCL2L11      -------HGVSQLHGCVAGMQ---------------------------AL
A0A3B4BVX1_BCL2L11      -------HGAGRNGGRVQLPAEEEPAFM-----------------LWLGL
A0A3P8XIA2_BCL2L11      HGRLGARNGQ--VAQANLPQMHQEPAFL-----------------LWMGL
A0A3Q1ICY2_BCL2L11      --EVAGRHRWVGIQPIRLPHIHQDPTVL-----------------LCVGL
A0A3Q3K6I5_BCL2L11      --ELADRRRRV------VPRIHQELTIV-----------------LCVGI
A0A3B4V919_BCL2L11      KHTKMTSQCCQTH--------------------------------FC---
A0A3B4XZH1_BCL2L11      LRVSHHRWCVCVC--------------------------------VCVCA
A0A3Q3ESW6_BCL2L11      W-RMAGRHGRPEVHPNPQPHIQPEPTML-----------------LCTGL
A0A3Q2SZH6_BCL2L11      --RMAGRQQRDMVPLNLMPHIQQEPVAM-----------------LCVGL
A0A3B3VNE0_BCL2L11      VRRMARRHQRNIVPLNLMPHIQQEPVAM-----------------LCVCL
A0A3B3YII5_BCL2L11      --RMARRHQRNIVPLNLMPHIQQEPVAM-----------------LCVCL
A0A3B3YII5_BCL2L11      --RMARRHQRNIVPLNLMPHIQQEPVAM-----------------LCVCL
A0A3P9N073_BCL2L11      -----------VLPVQLMIQQFSHATSIGIKKRKRVGYDDDYYHYYIDCF
A0A3Q3B113_BCL2L11      LRRMAGRPRRNIVPLNLLPHIHQEPVAM-----------------LCVSL
A0A3B5M375_BCL2L11      ------------IAVNIGPVLFIRPIPM-----------------L-VPI
A0A3B5QAM1_BCL2L11      GRRMARGHQRNIVPLNLMPHIQQEPVAM-----------------LCVCL
A0A3B5QAM1_BCL2L11      GRRMARGHQRNIVPLNLMPHIQQEPVAM-----------------LCVCL
A0A3G3M2M0_BCL2L11      EHAIIMWMN---------------------------------------DL
A0A3Q1ELG4_BCL2L11      QRKTSLTFS-----AVVFALAIVC---P-----------------CLLSF
A0A3Q1CI15_BCL2L11      TREISCTFNLCNSFCTLFSVTVFCHLQS-----------------LFAST
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       GAGVNQLRAPNEHAIVLWMNVIIGRLVH-----------------FFLRR
B8JK68_BCL2L11-01       GAGVNQLHAPNEHAIVLWMNDIIGRLVH-----------------FFLRR
A0A3B3QC78_BCL2L11      GQGATLTPYPGDNKNKESPLRSRSSWLH-----------------VRMGE
A0A3Q2U844_BCL2L11      PRRGFLDNR----AG--NPQVVILRLLH-----------------YIIRL
G3SU55_BCL2L11-01       PRRAFL-NNYQAAED--HPQMVILRLLR-----------------YIVRL
G3W979_BCL2L11-01       PRRGFLDNNYQAADD--HHQMVILRLLH-----------------YIIRL
A0A3P8XIA2_BCL2L11      IHGVSGCSKMPVLHHLIYKPYQGPHCIK-----------------LS---
K7GA86_BCL2L11-01       PRRGFLDNQAI-------NHQIVLRLLH-----------------YIIRL
A0A3Q2GRS5_BCL2L11      PRRVVLNHHQAAEAH---PQMIILRLLR-----------------YIIRL
Q4KMV9_BCL2L11-01       PRRGIFNNLPRPLDN---DQVIILRVLR-----------------FIIRL
F7FTC8_BCL2L11-01       PRRGLLDNNNPAGNN---HQMGFVHLLR-----------------YIIRR
A0A2K6E226_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       TRRVFANDYREAEDH---PQMVILQLLR-----------------FIFRL
O54918_BCL2L11-08       TRRVFANDYREAEDH---PQMVILQLLR-----------------FIFRL
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       PRRVMLFSLPPFSPHTLPPPYI----------------------------
A0A2K6GE31_BCL2L11      PRRLAKCLVPSI--------------------------------------
A0A337SW42_BCL2L11      PRRLARVPASYI--------------------------------------
O43521_BCL2L11-17       ARRMPLPPD-----------------------------------------
O43521_BCL2L11-10       ARRMPLPPD-----------------------------------------
A0A2I2YQ13_BCL2L11      ARRLAKLLASST--------------------------------------
O43521_BCL2L11-19       ARRLAKLLASST--------------------------------------
O43521_BCL2L11-13       ARRLAKLLASST--------------------------------------
A0A2I3HW02_BCL2L11      ARRLAKLLASST--------------------------------------
A0A2R9CA99_BCL2L11      ARRLAKLLSST---------------------------------------
A0A2J8JCT2_BCL2L11      ARRLAKLLASST--------------------------------------
A0A2K5NU92_BCL2L11      ARRLAELLASST--------------------------------------
A0A2K5X2I7_BCL2L11      ARRLAELLASST--------------------------------------
F7HHA9_BCL2L11-05       ARRLAELLASST--------------------------------------
A0A2K5Z8B6_BCL2L11      ARRLAELLASST--------------------------------------
A0A2K5HZI7_BCL2L11      ARRLAKLLASST--------------------------------------
A0A2K6KJP8_BCL2L11      ARRLAKLLASST--------------------------------------
A0A2K6QIL2_BCL2L11      ARRLAKLLASST--------------------------------------
O54918_BCL2L11-05       TRRVFANDYREAEDH---PQMVILQLLR-----------------FIFRL
O88498_BCL2L11-02       TRRAFANDYREAEDH---PQMVILQLLR-----------------FIFRL
A0A0D9RWE0_BCL2L11      ARRL---------EK-----------------------------------
O43521_BCL2L11-05       ARRL---------EK-----------------------------------
O43521_BCL2L11-25       ARRL---------EK-----------------------------------
F1SU81_BCL2L11-03       PRRVMLFSLPPFSPHTLPPPYI----------------------------
A0A2K6GE31_BCL2L11      PRRVFLNNYQADEDH---PQMLILRLLR-----------------YIVRL
A0A286XJN2_BCL2L11      PRRVFLNHYQPAEDQ---PQMVILRLLR-----------------YIIRL
A0A2K5CAB2_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K6TRZ5_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K6QIL2_BCL2L11      ARRVFLNNYQAAEEH---PQMVILRLLR-----------------YIVRL
A0A2K5NU92_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5HZI7_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5X2I7_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6E226_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5Z8B6_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2I3M6I1_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2I3M6I1_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6KJP8_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2I2YQ13_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
O43521_BCL2L11-02       ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A2R9CA99_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A2J8JCT2_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
H2P5E2_BCL2L11-01       ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A337SW42_BCL2L11      PRRVFLNNYQAAEAQ---PQMIILRLLR-----------------YIVRL
A0A452SBG5_BCL2L11      PRRVFLNNYQAAEAH---PQMIILRLLR-----------------YIIRL
Q2YDF0_BCL2L11-01       PRRVFVRH-QAVEGH---PQMVLLRVLR-----------------YIVRL
A0A287DFJ0_BCL2L11      PRRVFFNN-YQPEDR---PQMVILRLLR-----------------CIIRL
Q2YDF0_BCL2L11-03       PRRVFVRH-QAVEGH---PQMVLLRVLR-----------------YIVRL
A0A452FCS1_BCL2L11      PRRVFVRH-QAIEGH---PQMVLLRVLR-----------------YLVRL
A0A2K5CAB2_BCL2L11      G-----HHHSQGTEQLHHKYFS----------------------------
A0A2K5Z8B6_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
A0A2K6KJP8_BCL2L11      VVWIYIYHHSQDTEQLNHRDFS----------------------------
A0A2K6QIL2_BCL2L11      VVWIYIYHHSQDTEQLNHRDFS----------------------------
F6XMC1_BCL2L11-09       G-----HHHSQGTEQQHKDFSW----------------------------
A0A2K6TRZ5_BCL2L11      G-----YHHSQGTEQLHHKYVS----------------------------
A0A2K5HZI7_BCL2L11      G-----HHHSQDTEQLNHRDFS----------------------------
A0A2R9CA99_BCL2L11      G-----HHHSQDAEQLNHKDFS----------------------------
A0A2J8JCT2_BCL2L11      G-----HHHSQDAEQLNHKDFS----------------------------
A0A2K5NU92_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
A0A2K5X2I7_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
F7HHA9_BCL2L11-09       G-----HHHSQDTEQLNHKDFS----------------------------
A0A2K6E226_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
A0A2I3M6I1_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
A0A2I2YQ13_BCL2L11      G-----HHHSQDTEQLNHKDFS----------------------------
O43521_BCL2L11-06       G-----HHHSQDTEQLNHKDFS----------------------------
O43521_BCL2L11-23       G-----HHHSQDTEQLNHKDFS----------------------------
A0A2I3HW02_BCL2L11      G-----HHHSQDTEQFNHKDFS----------------------------
M3YDI3_BCL2L11-01       PRRVFLNNYPAAEAH---PQMIILRLLR-----------------YIIRL
F6XMC1_BCL2L11-02       PRRVNWILPFCHRKEVCLEAFPVLPSKA-----------------SQSAY
F6XMC1_BCL2L11-01       PRRVNWILPFCHRKEVCLEAFPVLPSKA-----------------SQSAY
F7CXT2_BCL2L11-01       PRRGFLDNNYQGAGDH--HQMVILRLLR-----------------YIIRL
O54918_BCL2L11-01       TRRVFANDYREAEDH---PQMVILQLLR-----------------FIFRL
O88498_BCL2L11-01       TRRAFANDYREAEDH---PQMVILQLLR-----------------FIFRL
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       STRTHSLSARNSIHP-----------------------------------
A0A2K6GE31_BCL2L11      PRRVFLNNYQADEDH---PQMLILRLLR-----------------YIVRL
A0A2K6GE31_BCL2L11      PRRMPLPSD-----------------------------------------
A0A287DFJ0_BCL2L11      PRRVFFNNYQPEDR----PQMVILRLLR-----------------CIIRL
A0A286XJN2_BCL2L11      PRRVFLNHYQPAEDQ---PQMVILRLLR-----------------YIIRL
A0A286XJN2_BCL2L11      PRRVFLNHYQPAEDQ---PQMVILRLLR-----------------YIIRL
A0A2K5CAB2_BCL2L11      PRRLEK--------------------------------------------
F6XMC1_BCL2L11-07       PRRLEK--------------------------------------------
A0A2K6TRZ5_BCL2L11      PRRLEK--------------------------------------------
F6XMC1_BCL2L11-05       PRRISLLPD-----------------------------------------
A0A2K6TRZ5_BCL2L11      PRRISLPPD-----------------------------------------
A0A2K5CAB2_BCL2L11      PRRISLPSD-----------------------------------------
A0A2K5NU92_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2K5HZI7_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2K5X2I7_BCL2L11      ARRMSLPPD-----------------------------------------
F7HHA9_BCL2L11-02       ARRMSLPPD-----------------------------------------
A0A2K6E226_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2K5Z8B6_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2I3M6I1_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2K6KJP8_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2K6QIL2_BCL2L11      ARRMSLPPD-----------------------------------------
A0A2I2YQ13_BCL2L11      ARRMPLPPD-----------------------------------------
O43521_BCL2L11-09       ARRMPLPPD-----------------------------------------
O43521_BCL2L11-21       ARRMPLPPD-----------------------------------------
A0A2R9CA99_BCL2L11      ARRMPLPPD-----------------------------------------
A0A2J8JCT2_BCL2L11      ARRMPLPPD-----------------------------------------
A0A2K5NU92_BCL2L11      ARRLEK--------------------------------------------
A0A2K5HZI7_BCL2L11      ARRLEK--------------------------------------------
A0A2K5X2I7_BCL2L11      ARRLEK--------------------------------------------
F7HHA9_BCL2L11-04       ARRLEK--------------------------------------------
A0A2K6E226_BCL2L11      ARRLEK--------------------------------------------
A0A2K5Z8B6_BCL2L11      ARRLEK--------------------------------------------
A0A2I3M6I1_BCL2L11      ARRLEK--------------------------------------------
A0A2K6KJP8_BCL2L11      ARRLEK--------------------------------------------
A0A2K6QIL2_BCL2L11      ARRLEK--------------------------------------------
A0A2I2YQ13_BCL2L11      ARRLEK--------------------------------------------
O43521_BCL2L11-20       ARRLEK--------------------------------------------
A0A2I3HW02_BCL2L11      ARRLEK--------------------------------------------
A0A2R9CA99_BCL2L11      ARRLEK--------------------------------------------
A0A2J8JCT2_BCL2L11      ARRLEK--------------------------------------------
A0A2K5CAB2_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K5CAB2_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
F6XMC1_BCL2L11-03       PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K6TRZ5_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K6TRZ5_BCL2L11      PRRVFLNNYQAAEDH---PHMVILRLLR-----------------YIVRL
A0A2K6QIL2_BCL2L11      ARRVFLNNYQAAEEH---PQMVILRLLR-----------------YIVRL
A0A2K6QIL2_BCL2L11      ARRVFLNNYQAAEEH---PQMVILRLLR-----------------YIVRL
A0A2K5NU92_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5HZI7_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5X2I7_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6E226_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6E226_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K5Z8B6_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2I3M6I1_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6KJP8_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2K6KJP8_BCL2L11      ARRVFLNNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A2I2YQ13_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
O43521_BCL2L11-03       ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A2I3HW02_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A2R9CA99_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A2J8JCT2_BCL2L11      ARRVFLNNYQAAEDH---PRMVILRLLR-----------------YIVRL
A0A337SW42_BCL2L11      PRRLEQ--------------------------------------------
A0A452FCS1_BCL2L11      PRRVFV-RHQAIEGH---PQMVLLRVLR-----------------YLVRL
W5PY58_BCL2L11-01       PRRVFV-RHQAIEGH---PQMVLLRVLR-----------------YLVRL
Q2YDF0_BCL2L11-02       PRRVFV-RHQAVEGH---PQMVLLRVLR-----------------YIVRL
F1SU81_BCL2L11-02       PRRVMLFSLPPFSPHTLPPPYI----------------------------
G1SSY0_BCL2L11-01       PRRVFLNNYPAAEEQ---PQMVILRLLR-----------------YIVRL
H0XW23_BCL2L11-01       PTRVFLHNYQAAEDH---PQMVILRLLR-----------------YIVRL
A0A337SW42_BCL2L11      PRRVFLNNYQAAEAQ---PQMIILRLLR-----------------YIVRL
G1LDR8_BCL2L11-01       PRRVFLNNYQAAEAH---PQMIILRLLR-----------------YIVRL
J9NWV6_BCL2L11-01       PRRVFLNNYQAAEAH---PQMIILRLLR-----------------YIVRL
F1SU81_BCL2L11-01       PRRVFLNNYQAAEAH---PQMVILRLLR-----------------YIARL
                                                                          

Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       IWRMQ---------------------------------------------
G1PDJ5_BCL2L11-01       VWRRM---------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       IWRMQ---------------------------------------------
A0A3P8RLE2_BCL2L11      WKRC----------------------------------------------
A0A3B1JXK6_BCL2L11      LIERLRQFLHRRR-------------------------------------
A0A3B4BVX1_BCL2L11      F---------RGH-------------------------------------
A0A3B4BVX1_BCL2L11      SARDLHDQMFALS-------------------------------------
A0A3B4BVX1_BCL2L11      VIRRLLEVLLRRR-------------------------------------
A0A3P8XIA2_BCL2L11      LIGRLLQIIWRRR-------------------------------------
A0A3Q1ICY2_BCL2L11      LLFVIGRIIYSQGSTNSEGHSHV---------------------------
A0A3Q3K6I5_BCL2L11      LVLVIGQIIL-QGSINSQDNSQV---------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      CGCVCACGCVCGCVRVCGGGGGVE--------------------------
A0A3Q3ESW6_BCL2L11      MILLIGWIIYLRGNTNSHDHSQV---------------------------
A0A3Q2SZH6_BCL2L11      LLLLIGRIMYLQGSTNSHDHSQV---------------------------
A0A3B3VNE0_BCL2L11      LLLLVGRIMYMQGNTSSHDHSQV---------------------------
A0A3B3YII5_BCL2L11      LLLLVGRIMYMQGNTSSHDHSQV---------------------------
A0A3B3YII5_BCL2L11      LLLLVGRIMYMQGNTSSHDHSQV---------------------------
A0A3P9N073_BCL2L11      FLKSVSKYDVA---------------------------------------
A0A3Q3B113_BCL2L11      LLLLIGRLMYLQGCTNSQNNSQV---------------------------
A0A3B5M375_BCL2L11      YHASTLRISALE--------------------------------------
A0A3B5QAM1_BCL2L11      LLLLVGRIMYMQGNTSSHDHSQV---------------------------
A0A3B5QAM1_BCL2L11      LLLLVGRIMYMQGNTSSHDHSQV---------------------------
A0A3G3M2M0_BCL2L11      IGRVVQFFLRRR--------------------------------------
A0A3Q1ELG4_BCL2L11      LFTVCFRFCNKRVK------------------------------------
A0A3Q1CI15_BCL2L11      LQNVLIRFINPNYFSTFWNRC-----------------------------
A0A3Q3SYA1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       R-------------------------------------------------
B8JK68_BCL2L11-01       R-------------------------------------------------
A0A3B3QC78_BCL2L11      VEQQEIV-------------------------------------------
A0A3Q2U844_BCL2L11      IWRMQ---------------------------------------------
G3SU55_BCL2L11-01       VWR-----------------------------------------------
G3W979_BCL2L11-01       VWRMQ---------------------------------------------
A0A3P8XIA2_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       IWRMQ---------------------------------------------
A0A3Q2GRS5_BCL2L11      VRRLQ---------------------------------------------
Q4KMV9_BCL2L11-01       ILRL----------------------------------------------
F7FTC8_BCL2L11-01       VWRLQ---------------------------------------------
A0A2K6E226_BCL2L11      VWRMH---------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       VWRRH---------------------------------------------
O54918_BCL2L11-08       VWRRH---------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
O54918_BCL2L11-05       VWRRH---------------------------------------------
O88498_BCL2L11-02       VWRRH---------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A2K6GE31_BCL2L11      VWRRH---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
A0A2K5CAB2_BCL2L11      VWRMH---------------------------------------------
A0A2K6TRZ5_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIL2_BCL2L11      VWRMH---------------------------------------------
A0A2K5NU92_BCL2L11      VWRMH---------------------------------------------
A0A2K5HZI7_BCL2L11      VWRMH---------------------------------------------
A0A2K5X2I7_BCL2L11      VWRMH---------------------------------------------
A0A2K6E226_BCL2L11      VWRMH---------------------------------------------
A0A2K5Z8B6_BCL2L11      VWRMH---------------------------------------------
A0A2I3M6I1_BCL2L11      VWRMH---------------------------------------------
A0A2I3M6I1_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJP8_BCL2L11      VWRMH---------------------------------------------
A0A2I2YQ13_BCL2L11      VWRMH---------------------------------------------
O43521_BCL2L11-02       VWRMH---------------------------------------------
A0A2R9CA99_BCL2L11      VWRMH---------------------------------------------
A0A2J8JCT2_BCL2L11      VWRMH---------------------------------------------
H2P5E2_BCL2L11-01       VWRMH---------------------------------------------
A0A337SW42_BCL2L11      VWRLQ---------------------------------------------
A0A452SBG5_BCL2L11      VWRLQ---------------------------------------------
Q2YDF0_BCL2L11-01       VWRMQ---------------------------------------------
A0A287DFJ0_BCL2L11      VWRMH---------------------------------------------
Q2YDF0_BCL2L11-03       VWRMQ---------------------------------------------
A0A452FCS1_BCL2L11      VWRMQ---------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       VWRLQ---------------------------------------------
F6XMC1_BCL2L11-02       WTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPV
F6XMC1_BCL2L11-01       WTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPV
F7CXT2_BCL2L11-01       VWRMQ---------------------------------------------
O54918_BCL2L11-01       VWRRH---------------------------------------------
O88498_BCL2L11-01       VWRRH---------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      VWRRH---------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      VWRMH---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
A0A286XJN2_BCL2L11      VWRMH---------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      VWRMH---------------------------------------------
A0A2K5CAB2_BCL2L11      VWRMH---------------------------------------------
F6XMC1_BCL2L11-03       VWRMH---------------------------------------------
A0A2K6TRZ5_BCL2L11      VWRMH---------------------------------------------
A0A2K6TRZ5_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIL2_BCL2L11      VWRMH---------------------------------------------
A0A2K6QIL2_BCL2L11      VWRMH---------------------------------------------
A0A2K5NU92_BCL2L11      VWRMH---------------------------------------------
A0A2K5HZI7_BCL2L11      VWRMH---------------------------------------------
A0A2K5X2I7_BCL2L11      VWRMH---------------------------------------------
A0A2K6E226_BCL2L11      VWRMH---------------------------------------------
A0A2K6E226_BCL2L11      VWRMH---------------------------------------------
A0A2K5Z8B6_BCL2L11      VWRMH---------------------------------------------
A0A2I3M6I1_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJP8_BCL2L11      VWRMH---------------------------------------------
A0A2K6KJP8_BCL2L11      VWRMH---------------------------------------------
A0A2I2YQ13_BCL2L11      VWRMH---------------------------------------------
O43521_BCL2L11-03       VWRMH---------------------------------------------
A0A2I3HW02_BCL2L11      VWRMH---------------------------------------------
A0A2R9CA99_BCL2L11      VWRMH---------------------------------------------
A0A2J8JCT2_BCL2L11      VWRMH---------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A452FCS1_BCL2L11      VWRMQ---------------------------------------------
W5PY58_BCL2L11-01       VWRMQ---------------------------------------------
Q2YDF0_BCL2L11-02       VWRMQ---------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
G1SSY0_BCL2L11-01       VWRMH---------------------------------------------
H0XW23_BCL2L11-01       VWRLH---------------------------------------------
A0A337SW42_BCL2L11      VWRLQ---------------------------------------------
G1LDR8_BCL2L11-01       VWRLQ---------------------------------------------
J9NWV6_BCL2L11-01       VWRLQ---------------------------------------------
F1SU81_BCL2L11-01       VWRMQ---------------------------------------------
                                                                          

Q6JTU4_BCL2L11-01       ---------------
G1MV54_BCL2L11-01       ---------------
G1PDJ5_BCL2L11-01       ---------------
M3XHJ5_BCL2L11-01       ---------------
R4G9R5_BCL2L11-01       ---------------
A0A3P8RLE2_BCL2L11      ---------------
A0A3B1JXK6_BCL2L11      ---------------
A0A3B4BVX1_BCL2L11      ---------------
A0A3B4BVX1_BCL2L11      ---------------
A0A3B4BVX1_BCL2L11      ---------------
A0A3P8XIA2_BCL2L11      ---------------
A0A3Q1ICY2_BCL2L11      ---------------
A0A3Q3K6I5_BCL2L11      ---------------
A0A3B4V919_BCL2L11      ---------------
A0A3B4XZH1_BCL2L11      ---------------
A0A3Q3ESW6_BCL2L11      ---------------
A0A3Q2SZH6_BCL2L11      ---------------
A0A3B3VNE0_BCL2L11      ---------------
A0A3B3YII5_BCL2L11      ---------------
A0A3B3YII5_BCL2L11      ---------------
A0A3P9N073_BCL2L11      ---------------
A0A3Q3B113_BCL2L11      ---------------
A0A3B5M375_BCL2L11      ---------------
A0A3B5QAM1_BCL2L11      ---------------
A0A3B5QAM1_BCL2L11      ---------------
A0A3G3M2M0_BCL2L11      ---------------
A0A3Q1ELG4_BCL2L11      ---------------
A0A3Q1CI15_BCL2L11      ---------------
A0A3Q3SYA1_BCL2L11      ---------------
B2KKY9_BCL2L11-01       ---------------
B8JK68_BCL2L11-01       ---------------
A0A3B3QC78_BCL2L11      ---------------
A0A3Q2U844_BCL2L11      ---------------
G3SU55_BCL2L11-01       ---------------
G3W979_BCL2L11-01       ---------------
A0A3P8XIA2_BCL2L11      ---------------
K7GA86_BCL2L11-01       ---------------
A0A3Q2GRS5_BCL2L11      ---------------
Q4KMV9_BCL2L11-01       ---------------
F7FTC8_BCL2L11-01       ---------------
A0A2K6E226_BCL2L11      ---------------
O43521_BCL2L11-11       ---------------
F7HHA9_BCL2L11-08       ---------------
O54918_BCL2L11-06       ---------------
O54918_BCL2L11-08       ---------------
O54918_BCL2L11-03       ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-15       ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
F7HHA9_BCL2L11-07       ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
O43521_BCL2L11-07       ---------------
O43521_BCL2L11-22       ---------------
A0A452U4S4_BCL2L11      ---------------
C1KGB8_BCL2L11-01       ---------------
A0A2K6GE31_BCL2L11      ---------------
A0A337SW42_BCL2L11      ---------------
O43521_BCL2L11-17       ---------------
O43521_BCL2L11-10       ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-19       ---------------
O43521_BCL2L11-13       ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-05       ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
O54918_BCL2L11-05       ---------------
O88498_BCL2L11-02       ---------------
A0A0D9RWE0_BCL2L11      ---------------
O43521_BCL2L11-05       ---------------
O43521_BCL2L11-25       ---------------
F1SU81_BCL2L11-03       ---------------
A0A2K6GE31_BCL2L11      ---------------
A0A286XJN2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-02       ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
H2P5E2_BCL2L11-01       ---------------
A0A337SW42_BCL2L11      ---------------
A0A452SBG5_BCL2L11      ---------------
Q2YDF0_BCL2L11-01       ---------------
A0A287DFJ0_BCL2L11      ---------------
Q2YDF0_BCL2L11-03       ---------------
A0A452FCS1_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
F6XMC1_BCL2L11-09       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-09       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-06       ---------------
O43521_BCL2L11-23       ---------------
A0A2I3HW02_BCL2L11      ---------------
M3YDI3_BCL2L11-01       ---------------
F6XMC1_BCL2L11-02       VKSALKLPWFHSPVA
F6XMC1_BCL2L11-01       VKSALKLPWFHSPVA
F7CXT2_BCL2L11-01       ---------------
O54918_BCL2L11-01       ---------------
O88498_BCL2L11-01       ---------------
A0A337SW42_BCL2L11      ---------------
A0A337SW42_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-24       ---------------
O43521_BCL2L11-08       ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-03       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
F6XMC1_BCL2L11-06       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
F6XMC1_BCL2L11-04       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-18       ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-01       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-16       ---------------
O43521_BCL2L11-12       ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-06       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K6GE31_BCL2L11      ---------------
A0A2K6GE31_BCL2L11      ---------------
F6XMC1_BCL2L11-08       ---------------
A0A2K6GE31_BCL2L11      ---------------
A0A2K6GE31_BCL2L11      ---------------
A0A287DFJ0_BCL2L11      ---------------
A0A286XJN2_BCL2L11      ---------------
A0A286XJN2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
F6XMC1_BCL2L11-07       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
F6XMC1_BCL2L11-05       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-02       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-09       ---------------
O43521_BCL2L11-21       ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
F7HHA9_BCL2L11-04       ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-20       ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
A0A2K5CAB2_BCL2L11      ---------------
F6XMC1_BCL2L11-03       ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K6TRZ5_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K6QIL2_BCL2L11      ---------------
A0A2K5NU92_BCL2L11      ---------------
A0A2K5HZI7_BCL2L11      ---------------
A0A2K5X2I7_BCL2L11      ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K6E226_BCL2L11      ---------------
A0A2K5Z8B6_BCL2L11      ---------------
A0A2I3M6I1_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2K6KJP8_BCL2L11      ---------------
A0A2I2YQ13_BCL2L11      ---------------
O43521_BCL2L11-03       ---------------
A0A2I3HW02_BCL2L11      ---------------
A0A2R9CA99_BCL2L11      ---------------
A0A2J8JCT2_BCL2L11      ---------------
A0A337SW42_BCL2L11      ---------------
A0A452FCS1_BCL2L11      ---------------
W5PY58_BCL2L11-01       ---------------
Q2YDF0_BCL2L11-02       ---------------
F1SU81_BCL2L11-02       ---------------
G1SSY0_BCL2L11-01       ---------------
H0XW23_BCL2L11-01       ---------------
A0A337SW42_BCL2L11      ---------------
G1LDR8_BCL2L11-01       ---------------
J9NWV6_BCL2L11-01       ---------------
F1SU81_BCL2L11-01       ---------------
                                       

© 1998-2019