Dataset for protein Bim of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

245 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       --------------------------------------------------
A0A3B1JXK6_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
A0A3B4BVX1_BCL2L11      --------------------------------------------------
W5UEE7_BCL2L11-01       --------------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      --------------------------------------------------
A0A3B3VNE0_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B3YII5_BCL2L11      --------------------------------------------------
A0A3B5M375_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
A0A3B5QAM1_BCL2L11      --------------------------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       ------------MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFP
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLC
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       --------------------------------------------------
F7CXT2_BCL2L11-01       --------------------------------------------------
O54918_BCL2L11-01       --------------------------------------------------
O88498_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-03       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-03       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-02       --------------------------------------------------
W5PY58_BCL2L11-01       --------------------------------------------------
G1SSY0_BCL2L11-01       --------------------------------------------------
H0XW23_BCL2L11-01       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
G1LDR8_BCL2L11-01       --------------------------------------------------
J9NWV6_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-01       --------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------MPTEESLQFDKDQGTSDV
R4G9R5_BCL2L11-01       ------------------------------------------MLVVGSSQ
A0A3B1JXK6_BCL2L11      ------------------------------------MSRPSNRATRPPFL
A0A3B4BVX1_BCL2L11      -----------LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFL
A0A3B4BVX1_BCL2L11      ----------------------------------------MQNSNYCCF-
A0A3B4BVX1_BCL2L11      ------------------------------------MSRRSNRAGRPAFL
W5UEE7_BCL2L11-01       ----------------------------------------MLFARRRRFF
A0A3B4V919_BCL2L11      ----------------------------MKAQADGAALFIQQTTKPVRWL
A0A3B4XZH1_BCL2L11      ----------------------------MKAQADGAALFIQQTTKPVRWL
A0A3B3VNE0_BCL2L11      ----------------------------------------MHSSRPPNLL
A0A3B3YII5_BCL2L11      ----------------------------------------MHSLRPPNLL
A0A3B3YII5_BCL2L11      ----------------------------------------MHSLRPPNLL
A0A3B5M375_BCL2L11      ----------------------------------MLTVTLCSSNRPPNLL
A0A3B5QAM1_BCL2L11      ----------------------------------MLTVTLCSSNRPPNLL
A0A3B5QAM1_BCL2L11      ----------------------------------------MHSLRPPNLL
B2KKY9_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
B8JK68_BCL2L11-01       ---------------------------------MSDTSREQTLANGPASQ
A0A3B3QC78_BCL2L11      --------------------------------------MGQILLTIPCSV
K7GA86_BCL2L11-01       APAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQMAKQPSDL
G3SU55_BCL2L11-01       ------------------------------------------MAKQPSDV
G3W979_BCL2L11-01       ------------------------------------------MAKQPSDL
Q4KMV9_BCL2L11-01       ------------------------------------------MAKQPSVL
F7FTC8_BCL2L11-01       ------------------------------------------MAKQPSDL
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
M3YDI3_BCL2L11-01       LPRFFRAEGQGAPGRRRTRAGRRGARARTRRSEGKGRTKKDQMAKQPSDV
F6XMC1_BCL2L11-02       ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-01       ------------------------------------------MAKQPSDV
F7CXT2_BCL2L11-01       ------------------------------------------MAKQPSDL
O54918_BCL2L11-01       ------------------------------------------MAKQPSDV
O88498_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-22       ------------------------------------------MAKQPSDV
O43521_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-24       ------------------------------------------MAKQPSDV
O43521_BCL2L11-12       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-06       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-21       ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-08       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-16       ------------------------------------------MAKQPSDV
O43521_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-04       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-18       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-02       ------------------------------------------MAKQPSDV
W5PY58_BCL2L11-01       ------------------------------------------MAKQPSDV
G1SSY0_BCL2L11-01       ------------------------------------------MAKQPSDV
H0XW23_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
G1LDR8_BCL2L11-01       ------------------------------------------MAKQPSDV
J9NWV6_BCL2L11-01       ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-01       ------------------------------------------MAKQPSDV
O43521_BCL2L11-11       ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-08       ------------------------------------------MAKQPSDV
O54918_BCL2L11-06       ------------------------------------------MAKQPSDV
O54918_BCL2L11-03       ------------------------------------------MAKQPSDV
O43521_BCL2L11-07       ------------------------------------------MAKQPSDV
O43521_BCL2L11-19       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-23       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-07       ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
C1KGB8_BCL2L11-01       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-10       ------------------------------------------MAKQPSDV
O43521_BCL2L11-20       ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-17       ------------------------------------------MAKQPSDV
O43521_BCL2L11-13       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-05       ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
F6XMC1_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
F7HHA9_BCL2L11-09       ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-06       ------------------------------------------MAKQPSDV
O43521_BCL2L11-15       ------------------------------------------MAKQPSDV
A0A2I3HW02_BCL2L11      ------------------------------------------MAKQPSDV
F1SU81_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A0D9RWE0_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-05       ------------------------------------------MAKQPSDV
O43521_BCL2L11-25       ------------------------------------------MAKQPSDV
O54918_BCL2L11-05       ------------------------------------------MAKQPSDV
O88498_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2K6GE31_BCL2L11      ------------------------------------------MAKQPSDV
A0A286XJN2_BCL2L11      ------------------------------------------MAKQPSDV
A0A337SW42_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5CAB2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6TRZ5_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6QIL2_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5NU92_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5HZI7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5X2I7_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6E226_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K5Z8B6_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I3M6I1_BCL2L11      ------------------------------------------MAKQPSDV
A0A2K6KJP8_BCL2L11      ------------------------------------------MAKQPSDV
A0A2I2YQ13_BCL2L11      ------------------------------------------MAKQPSDV
O43521_BCL2L11-02       ------------------------------------------MAKQPSDV
A0A2R9CA99_BCL2L11      ------------------------------------------MAKQPSDV
A0A2J8JCT2_BCL2L11      ------------------------------------------MAKQPSDV
H2P5E2_BCL2L11-01       ------------------------------------------MAKQPSDV
Q2YDF0_BCL2L11-01       ----------MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDV
Q2YDF0_BCL2L11-03       ------------------------------------------MAKQPSDV
A0A287DFJ0_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

U3IW89_BCL2L11-01       ------------------------SSS-----------------------
Q6JTU4_BCL2L11-01       ---------------MRQAEPADMRPE-----------------------
G1MV54_BCL2L11-01       --------------------FLLCAAS-----------------------
G1PDJ5_BCL2L11-01       --------------------------S-----------------------
M3XHJ5_BCL2L11-01       ISECGH-----LHPTQRPDQPPFVKQE-----------------------
R4G9R5_BCL2L11-01       PQLCLL--------------PKQLNVL-----------------------
A0A3B1JXK6_BCL2L11      KEQGERGQSGGGGGT--------------------LSRAEQCEQPEPGDG
A0A3B4BVX1_BCL2L11      KEQGESGQSSGAASS--------------------RA-AEQCEQPEPGEG
A0A3B4BVX1_BCL2L11      -EQGESGQSSGAAS---------------------SRAAEQCEQPEPGEG
A0A3B4BVX1_BCL2L11      KEQGESGQSSGAAS---------------------SRAAEQCEQPEPGEG
W5UEE7_BCL2L11-01       --------------------FCPWSPE-----AVCPRNMSKRQYRADGPA
A0A3B4V919_BCL2L11      DRSNG-KRGERRGSTTR---RCRWSPS-----A--KPQFERQRRAE----
A0A3B4XZH1_BCL2L11      DRSNG-KRGERRGSTTR---RCRWSPG-----A--KPQFERQRRAE----
A0A3B3VNE0_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSCAPQTGAS
A0A3B3YII5_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSCAPQAGAS
A0A3B3YII5_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSCAPQAGAS
A0A3B5M375_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSRAPQAGAS
A0A3B5QAM1_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSRAPQAGAS
A0A3B5QAM1_BCL2L11      DGSTEVTPAEGTGGDPA---SSARTPR-----S--SKHTERSRAPQAGAS
B2KKY9_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPG------------------EGDPL
B8JK68_BCL2L11-01       GSGEST-GGGVVLPAGH---FDFPQPG------------------EGDPL
A0A3B3QC78_BCL2L11      CSAEDK-ITRMAESRNPVAEQTPIQAGPRTAKVPGQLQATPR--------
K7GA86_BCL2L11-01       NSECDG-EGGQFQSIERPSQPQHLRPG-----APTSIQTQYQ--------
G3SU55_BCL2L11-01       SSECDR-EGGQLQPAERPPQPPQLRPG-----APTSLLTEPQGNPDG---
G3W979_BCL2L11-01       NSECDR-EGGQLQPTERPTQ-PQLRPG-----APTSIQTQYQGN-SG---
Q4KMV9_BCL2L11-01       SPDCNSGEGGQLQSTSRQHSHRPLRRG-----APTSLSSPFQ----GNQS
F7FTC8_BCL2L11-01       NSECDS-EGGRLEPAEGPAQPPQLRPG-----APTSIRTQYQ--------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTDP---------
M3YDI3_BCL2L11-01       SSECDR-EGGQLQPVER---PPQLRPG-----APTSLQTEQQ--------
F6XMC1_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F6XMC1_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7CXT2_BCL2L11-01       NSECDR-EGGQLQPTERPTQPQQLRPG-----APTSIQTQYQGNS-----
O54918_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQGNPDG---
O88498_BCL2L11-01       NSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTESQGNPDG---
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPE----
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPE----
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-22       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7HHA9_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F6XMC1_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F6XMC1_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-24       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-12       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7HHA9_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-21       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7HHA9_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQGNPEGSRE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQGNPEGSRE
F6XMC1_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQGNPEGSRE
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQGNPEGSRE
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQGNPEG---
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----APTSLQTEPQGNPEG---
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----APTSLQTEPQGNPEG---
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F6XMC1_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F6XMC1_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7HHA9_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-16       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F7HHA9_BCL2L11-04       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-18       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F6XMC1_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEDNHG
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
O43521_BCL2L11-03       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQGNPEGNHG
F1SU81_BCL2L11-02       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQGNPEG---
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPEG---
Q2YDF0_BCL2L11-02       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQGNPEG---
W5PY58_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQGNPEG---
G1SSY0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQSEPQGNP-----
H0XW23_BCL2L11-01       GSECDR-EGGQLQPAER---PPQLRPG-----APTSLHTEPQGNPEGNPE
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPEG---
G1LDR8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPEG---
J9NWV6_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQGNPEG---
F1SU81_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQGNPEG---
O43521_BCL2L11-11       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F7HHA9_BCL2L11-08       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O54918_BCL2L11-08       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O54918_BCL2L11-06       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O54918_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-19       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-23       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F7HHA9_BCL2L11-07       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
C1KGB8_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQ--------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQ--------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQ--------
O43521_BCL2L11-10       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-20       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-17       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-13       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F7HHA9_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F6XMC1_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F7HHA9_BCL2L11-09       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-06       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-15       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3HW02_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
F1SU81_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQ--------
A0A0D9RWE0_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-05       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-25       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O54918_BCL2L11-05       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O88498_BCL2L11-02       NSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTESQ--------
A0A2K6GE31_BCL2L11      GSECDR-EGGQLQSVER---PPQLRPG-----APTSLQTEPQ--------
A0A286XJN2_BCL2L11      SCECDR-EGGQLQPAER---PSQLRAG-----APTSLQTEPQ--------
A0A337SW42_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEQQ--------
A0A2K5CAB2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6TRZ5_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6QIL2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5NU92_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5HZI7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5X2I7_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6E226_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K5Z8B6_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I3M6I1_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2K6KJP8_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2I2YQ13_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
O43521_BCL2L11-02       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2R9CA99_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
A0A2J8JCT2_BCL2L11      SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
H2P5E2_BCL2L11-01       SSECDR-EGRQLQPAER---PPQLRPG-----APTSLQTEPQ--------
Q2YDF0_BCL2L11-01       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQ--------
Q2YDF0_BCL2L11-03       SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTERQ--------
A0A287DFJ0_BCL2L11      SSECDR-EGGQLQPAER---PPQLRPG-----APTSLQTEPQ--------
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --GCYCIISPLSKVIALVRWRDRSLLSTLMGGLLLPPSPCPFVTRSPFFI
R4G9R5_BCL2L11-01       -----------------------------------------SANAFAISC
A0A3B1JXK6_BCL2L11      DPVRGPPAL--------------------------HNSLLGYQTRSPLF-
A0A3B4BVX1_BCL2L11      DPVRGGITM--------------------------PNSLLGYQSRSPLF-
A0A3B4BVX1_BCL2L11      DPVRGGITM--------------------------PNSLLGYQSRSPLF-
A0A3B4BVX1_BCL2L11      DPVRGGITM--------------------------PNSLLGYQSRSPLF-
W5UEE7_BCL2L11-01       FLKEHGGRGESASRAEPYESPQHRELEVIRGGIALPNSRVAYQSRSPVF-
A0A3B4V919_BCL2L11      -------------PWPPRLHRRRRARL--------AAPVQNHSHLS-CQ-
A0A3B4XZH1_BCL2L11      -------------TIA--------TSP--------GNSLGVFQKRS-IF-
A0A3B3VNE0_BCL2L11      TAGGGGGGGGGG-GGEPDADSPPCSVS--------PASLDVFRSRS-IF-
A0A3B3YII5_BCL2L11      TAGGGGGGGGGG-RGEPDSDSPPCSVS--------PASLDVFRSRS-IF-
A0A3B3YII5_BCL2L11      TAGGGGGGGGGG-RGEPDSDSPPCSVS--------PASLDVFRSRS-IF-
A0A3B5M375_BCL2L11      TAGGGGGGEGEGRRGEPDSDSPPCSVS--------PASLDVFRSRS-IF-
A0A3B5QAM1_BCL2L11      TAGGGGGGEGGGRRGEPDSDSPPCSVS--------PASLDVFRSRS-IF-
A0A3B5QAM1_BCL2L11      TAGGGGGGEGGGRRGEPDSDSPPCSVS--------PASLDVFRSRS-IF-
B2KKY9_BCL2L11-01       RGGISMSNNQSRSPM-----------------------------------
B8JK68_BCL2L11-01       RGGISMSNNQSRSPM-----------------------------------
A0A3B3QC78_BCL2L11      --------------------------------------------------
K7GA86_BCL2L11-01       --------------------------------------------------
G3SU55_BCL2L11-01       -EGDSCPQGSPQGPQAP------------------PASPGPFATRSPLFI
G3W979_BCL2L11-01       -EGDSCSPSSPQGPFAP------------------PTSPSPFATRSPLFI
Q4KMV9_BCL2L11-01       DEGGSSSASTPWGPTIS------------------PYSPSSFVNRSPHCM
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      ---------------------------------------GPFATRSP---
M3YDI3_BCL2L11-01       --------------------------------------------------
F6XMC1_BCL2L11-02       --------------------------------------------------
F6XMC1_BCL2L11-01       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
F7CXT2_BCL2L11-01       GEGDSCSPSSPQGPFAP------------------PTSPSPFATRSPLFI
O54918_BCL2L11-01       -EGDRCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O88498_BCL2L11-01       -EGDRCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A337SW42_BCL2L11      GEGDRCPQGSPQGPLAP------------------PASPGPFATRSPFFI
A0A337SW42_BCL2L11      GEGDRCPQGSPQGPLAP------------------PASPGPFATRSPFFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-22       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-08       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F7HHA9_BCL2L11-03       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3HW02_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-06       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-04       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-24       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-12       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F7HHA9_BCL2L11-06       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3HW02_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-21       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F7HHA9_BCL2L11-01       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3HW02_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6GE31_BCL2L11      GEGDRCSHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6GE31_BCL2L11      GEGDRCSHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-08       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6GE31_BCL2L11      GEGDRCSHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6GE31_BCL2L11      GEGDRCSHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A287DFJ0_BCL2L11      -EGDRCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A286XJN2_BCL2L11      -AGDRSPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A286XJN2_BCL2L11      -AGDRSPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-07       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-05       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F7HHA9_BCL2L11-02       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-16       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-09       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F7HHA9_BCL2L11-04       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-18       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3HW02_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5CAB2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F6XMC1_BCL2L11-03       GEGDSCLHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6TRZ5_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5NU92_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5HZI7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5X2I7_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6E226_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K5Z8B6_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3M6I1_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2K6KJP8_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I2YQ13_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
O43521_BCL2L11-03       GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2I3HW02_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2R9CA99_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
A0A2J8JCT2_BCL2L11      GEGDSCPHGSPQGPLAP------------------PASPGPFATRSPLFI
F1SU81_BCL2L11-02       -EGDRCPQGSPQGPLAP------------------PTSPGPFATRSPLFI
A0A337SW42_BCL2L11      -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPFFI
Q2YDF0_BCL2L11-02       -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPLFI
W5PY58_BCL2L11-01       -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPLFI
G1SSY0_BCL2L11-01       -EGDRCAHGSPQGPLAP------------------SASPGPFATRSPLFI
H0XW23_BCL2L11-01       VEGDRCPQGSPQGPLAP------------------PASPGPFATRSPLFI
A0A337SW42_BCL2L11      -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPFFI
G1LDR8_BCL2L11-01       -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPLFI
J9NWV6_BCL2L11-01       -EGDRCPQGSPQGPLAP------------------PASPGPFATRSPLFI
F1SU81_BCL2L11-01       -EGDRCPQGSPQGPLAP------------------PTSPGPFATRSPLFI
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       -------------GYFSFEAE--RSPAP-M-----SCDKATQTPSPPCQA
Q6JTU4_BCL2L11-01       -------------IWIAQELR--RIGDE-F-----NAYYARRLEK-----
G1MV54_BCL2L11-01       -----------------------RWRSHSL--------------------
G1PDJ5_BCL2L11-01       -----------------------MQQSQAL--------------------
M3XHJ5_BCL2L11-01       FMRRSLVLSTSSSGYFTFDSDIVHSPAP-V-----SVHKATQTPSPSSQL
R4G9R5_BCL2L11-01       FLYRDVPWRRTGRRWCEAETS--RWQSRPI--------------------
A0A3B1JXK6_BCL2L11      -----RTLSRSSSGYFSFDSE----PSSPL----LMHSASTQTPSPSSQV
A0A3B4BVX1_BCL2L11      -----RTLSRSSSGYFSFESE----PSSPL----VTHSASTQTPSPSSQV
A0A3B4BVX1_BCL2L11      -----RTLSRSSSGYFSFESE----PSSPL----LT--------SPSLSV
A0A3B4BVX1_BCL2L11      -----RTLSRSSSGYFSFESE----PSSPL----VTHSASTQTPSPSSQV
W5UEE7_BCL2L11-01       -----RTLSRSSSGYFSFDSE----PSSPL----ITHSTATQTPSPSSQV
A0A3B4V919_BCL2L11      -----HFSRRSSSGYFSFDSD--SLPSSPLSPRPATVERTTQTPSPTSQV
A0A3B4XZH1_BCL2L11      -----SYPRRSSSGYFSFDSD--SLPTSPLSPRPATAERTTQTPSPTSQV
A0A3B3VNE0_BCL2L11      -----RPPRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSPTGQV
A0A3B3YII5_BCL2L11      -----RPPRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSPTGQV
A0A3B3YII5_BCL2L11      -----RPPRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSPTGQV
A0A3B5M375_BCL2L11      -----RPTRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSLTGQV
A0A3B5QAM1_BCL2L11      -----RPPRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSLTGQV
A0A3B5QAM1_BCL2L11      -----RPPRRSSSGYFSFDCD--SLPSSPLSPHPVTADKATQTPSLTGQV
B2KKY9_BCL2L11-01       ----NRTFSRSSSGYFSVDSD--SVPGSPL-----MPNISEAQDGQNDEV
B8JK68_BCL2L11-01       ----NRTFSRSSSGYFSVDSD--SVPGSPL-----MPNISEAQDGQNDEV
A0A3B3QC78_BCL2L11      ----FSTLSASSSGYHSLDIS--LPNSPFM-----THNKSTQTPSPSNHL
K7GA86_BCL2L11-01       --------------------D--RSPVP-M-----SCDKSTQTPSPPCQA
G3SU55_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
G3W979_BCL2L11-01       FVRRSPLLPRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
Q4KMV9_BCL2L11-01       LVRGSSLVSKTSSGYFSF--E--VSPGP-V-----SCDKSTQTPSPPCQA
F7FTC8_BCL2L11-01       --------------------D--RSPPP-V-----SCDKSTQTPSPHCQA
A0A2K6E226_BCL2L11      ------------------------------------CDKSTQTPSPPCQA
M3YDI3_BCL2L11-01       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-02       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-01       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7CXT2_BCL2L11-01       FLRRSPLLPRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O54918_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O88498_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A337SW42_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A337SW42_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-22       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-08       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-03       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-06       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-04       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-24       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-12       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-06       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-21       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-01       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6GE31_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6GE31_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-08       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6GE31_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6GE31_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A287DFJ0_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A286XJN2_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A286XJN2_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-07       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-05       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-02       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-16       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-09       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-04       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-18       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-03       FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      FVRRSSVLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-03       FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      FMRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F1SU81_BCL2L11-02       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A337SW42_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
Q2YDF0_BCL2L11-02       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
W5PY58_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
G1SSY0_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
H0XW23_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
A0A337SW42_BCL2L11      FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
G1LDR8_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
J9NWV6_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
F1SU81_BCL2L11-01       FVRRSSLLSRSSSGYFSFDTD--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-11       -------------------------------------------VSLCHPG
F7HHA9_BCL2L11-08       -------------------------------------------VSLCCPS
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-07       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-19       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-23       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-07       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F6XMC1_BCL2L11-09       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F7HHA9_BCL2L11-09       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-06       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-15       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3HW02_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
F1SU81_BCL2L11-03       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A0D9RWE0_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-05       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-25       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O54918_BCL2L11-05       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O88498_BCL2L11-02       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6GE31_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A286XJN2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A337SW42_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5CAB2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6TRZ5_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6QIL2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5NU92_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5HZI7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5X2I7_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6E226_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K5Z8B6_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I3M6I1_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2K6KJP8_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2I2YQ13_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
O43521_BCL2L11-02       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2R9CA99_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A2J8JCT2_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
H2P5E2_BCL2L11-01       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
Q2YDF0_BCL2L11-01       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
Q2YDF0_BCL2L11-03       --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
A0A287DFJ0_BCL2L11      --------------------D--RSPAP-M-----SCDKSTQTPSPPCQA
                                                                          

U3IW89_BCL2L11-01       VSH-----------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       -----------------------------------AEEIQ-PEIWIAQEL
G1PDJ5_BCL2L11-01       -----------------------------------PVDMR-PEMWIAQEL
M3XHJ5_BCL2L11-01       IVHVQHCL-----AQREQHPETHGKN---------PLNFT----------
R4G9R5_BCL2L11-01       -----------------------------------PEDMQ-PEIWIAQEL
A0A3B1JXK6_BCL2L11      IIHALQRISEARGDAQSFELCP-GPNHCPPHRAAAAGDMQ-AHWYIAQEL
A0A3B4BVX1_BCL2L11      ITHALQRIAEARGNAQTFELWP-LYNHHPPHGAAPAGDMR-PESYVAQEL
A0A3B4BVX1_BCL2L11      CST---------------ELWP-LYNHHPPHGAAPAGDMR-PESYVAQEL
A0A3B4BVX1_BCL2L11      ITHALQRIAEARGNAQTFELWP-LYNHHPPHGAAPAGDMR-PESYVAQEL
W5UEE7_BCL2L11-01       ITHALQRISKARGDAQNHELWPALLNHYPPHGAASAGDMQ-AELEIAREL
A0A3B4V919_BCL2L11      MKHALQRMAEAHGGGARMQQQH----------------------------
A0A3B4XZH1_BCL2L11      MKHALQRMAEAHGGGARMQQQQHGEHRHFA-----SGDMQ-AE-AVGQEL
A0A3B3VNE0_BCL2L11      MNHALQRMAVEHGGLGLHGHSPNHYSTINA-----ARDMQ-SE-TFGRQL
A0A3B3YII5_BCL2L11      MNHALQRMAVEHGGLGLHGHSPNHYSTINA-----ARDMQ-SE-NFGRQL
A0A3B3YII5_BCL2L11      MNHALQRMAVEHGGLGLHGHSPNHYSTINA-----ARDMQ-SE-NFGRQL
A0A3B5M375_BCL2L11      MNHALQRMAVEHGGLGLQGEQT---SVLPP-----PPSET-ST-TWEQ--
A0A3B5QAM1_BCL2L11      MNHALQRMAVEHGGLGLHGQSPNHYSTINA-----ARDMQ-SE-TYGRQL
A0A3B5QAM1_BCL2L11      MNHALQRMAVEHGGLGLHGQSPNHYSTINA-----ARDMQ-SE-TYGRQL
B2KKY9_BCL2L11-01       ---WLSEH-----SHQHLQMAA-------------PVAALPPEMVVAREL
B8JK68_BCL2L11-01       ---WLSEH-----SHQHLQMAA-------------PVAALPPEMVVAREL
A0A3B3QC78_BCL2L11      VCIYLSSV--------TRTLSM-------------LPDMR-PEMLVAREL
K7GA86_BCL2L11-01       FNHYLSAMGKQDHASRWESPSI-------------REDMQ-PEIWIAQEL
G3SU55_BCL2L11-01       INHYLSAM-----ASMRQSQAL-------------PADLR-PEIWIAREL
G3W979_BCL2L11-01       FNHYLSAM---DTASMRQSQSI-------------PADMR-PEIWIAQEL
Q4KMV9_BCL2L11-01       FNHLLSAM-----ADRN------------------PVNQMSPELWIAQEL
F7FTC8_BCL2L11-01       FNHYLSAM-----ASIRQPQSV-------------PEDMR-PEIWIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
M3YDI3_BCL2L11-01       FNHYLSAM-----ASRRQSQAV-------------PADMR-PEMWIAQEL
F6XMC1_BCL2L11-02       FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
F6XMC1_BCL2L11-01       FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
F7CXT2_BCL2L11-01       FNHYLSAM-----ASMRQSQSI-------------PADMR-PEIWIAQEL
O54918_BCL2L11-01       FNHYLSAM-----ASIRQSQEE-------------PEDLR-PEIRIAQEL
O88498_BCL2L11-01       FNHYLSAM-----ASIRQSQEE-------------PEDLR-PEIRIAQEL
A0A337SW42_BCL2L11      FNHYLSAM-----------------------------------GLFE---
A0A337SW42_BCL2L11      FNHYLSAM-----VRAI------------------------EEGVL----
A0A2K5NU92_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K5HZI7_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2I2YQ13_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
O43521_BCL2L11-22       FNHYLSAM-----VREI------------------------EEVVV----
O43521_BCL2L11-08       FNHYLSAM-----VREI------------------------EEVVV----
A0A2K5X2I7_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
F7HHA9_BCL2L11-03       FNHYLSAM-----VREI------------------------EEVVV----
A0A2K6E226_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2I3HW02_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2R9CA99_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2J8JCT2_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2I3M6I1_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K6KJP8_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K6QIL2_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K5CAB2_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
F6XMC1_BCL2L11-06       FNHYLSAM-----VREI------------------------EEVVV----
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ADWD---------------------------------
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ADWD---------------------------------
A0A2K5CAB2_BCL2L11      FNHYLSAM-----GIFE---------------------------------
F6XMC1_BCL2L11-04       FNHYLSAM-----GIFE---------------------------------
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2K5NU92_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2K5HZI7_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2I2YQ13_BCL2L11      FNHYLSAM-----ANWD---------------------------------
O43521_BCL2L11-24       FNHYLSAM-----ANWD---------------------------------
O43521_BCL2L11-12       FNHYLSAM-----ANWD---------------------------------
A0A2K5X2I7_BCL2L11      FNHYLSAM-----ANWD---------------------------------
F7HHA9_BCL2L11-06       FNHYLSAM-----ANWD---------------------------------
A0A2K6E226_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2I3HW02_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2R9CA99_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2J8JCT2_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ANWD---------------------------------
A0A2K5NU92_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2I2YQ13_BCL2L11      FNHYLSAM-----GIFE---------------------------------
O43521_BCL2L11-21       FNHYLSAM-----GIFE---------------------------------
A0A2K5X2I7_BCL2L11      FNHYLSAM-----GIFE---------------------------------
F7HHA9_BCL2L11-01       FNHYLSAM-----GIFE---------------------------------
A0A2K6E226_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2I3HW02_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2R9CA99_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2J8JCT2_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2I3M6I1_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2K6KJP8_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2K6QIL2_BCL2L11      FNHYLSAM-----GIFE---------------------------------
A0A2K5HZI7_BCL2L11      FNHYLSAM-----GVFE---------------------------------
A0A2K6GE31_BCL2L11      FNHYLSAM-----VREI------------------------EEVVV----
A0A2K6GE31_BCL2L11      FNHYLSAM----------------------------------GIFE----
F6XMC1_BCL2L11-08       FNHYLSAM-----GYRLTGQQP-------------CLPWKVRGIGEKQEE
A0A2K6GE31_BCL2L11      FNHYLSAM-----ASMRQFQAE-------------PADMR-PEIWIAQEL
A0A2K6GE31_BCL2L11      FNHYLSAM-----ASMRQFQAE-------------PADMR-PEIWIAQEL
A0A287DFJ0_BCL2L11      FNHYLSAM-----ASMRESQAE-------------PADMR-PEIWIAQEL
A0A286XJN2_BCL2L11      FNHYLSAM-----ASMRQSQAG-------------PPHLR-PEIWIAQEL
A0A286XJN2_BCL2L11      FNHYLSAM-----ASMRQSQAG-------------PPHLR-PEIWIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
F6XMC1_BCL2L11-07       FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
F6XMC1_BCL2L11-05       FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K5NU92_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5HZI7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5X2I7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
F7HHA9_BCL2L11-02       FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I2YQ13_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-16       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-09       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2R9CA99_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2J8JCT2_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2K5NU92_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5HZI7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5X2I7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
F7HHA9_BCL2L11-04       FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I2YQ13_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-18       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2I3HW02_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2R9CA99_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2J8JCT2_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
F6XMC1_BCL2L11-03       FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5NU92_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5HZI7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5X2I7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I2YQ13_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-03       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2I3HW02_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2R9CA99_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2J8JCT2_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
F1SU81_BCL2L11-02       FNHYLSAM-----ASMRQSQAE-------------PADMR-PEIWIAQEL
A0A337SW42_BCL2L11      FNHYLSAM-----ASMRQPQAV-------------PADMR-PEIWIAQEL
Q2YDF0_BCL2L11-02       FNHYLSAM-----ASMRQSQAV-------------PADTR-PEIWIAQEL
W5PY58_BCL2L11-01       FNHYLSAM-----ASMRQSQAV-------------PADTR-PEIWIAQEL
G1SSY0_BCL2L11-01       FNHYLSAM-----ASMRQSQAE-------------PADTR-PETWIAQEL
H0XW23_BCL2L11-01       FNHYLSAM-----ASMRQSQAE-------------PADLR-PEMWIAQEL
A0A337SW42_BCL2L11      FNHYLSAM-----ASMRQPQAV-------------PADMR-PEIWIAQEL
G1LDR8_BCL2L11-01       FNHYLSAM-----ASMRQSQAV-------------PADMR-PEIWIAQEL
J9NWV6_BCL2L11-01       FNHYLSAM-----ASMRQSQAV-------------PADMR-PEIWIAQEL
F1SU81_BCL2L11-01       FNHYLSAM-----ASMRQSQAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-11       WSALVRSW-----LTATSNSQV-------------QAVLL-PQPPK----
F7HHA9_BCL2L11-08       WSALVLSW-----LTATSNSQV-------------QAVLL-PQPPK----
O54918_BCL2L11-08       -------------ASIRQSQEE-------------PEDLR-PEIRIAQEL
O54918_BCL2L11-06       -------------ASIRQSQEE-------------PEDLR-PEIRIAQEL
O54918_BCL2L11-03       FNHYLSAM-----DQLENLNQV-------------AQNIH-GDAWYN---
O43521_BCL2L11-07       FNHYLSAM-----VREIE-EVV-------------V--------------
O43521_BCL2L11-19       FNHYLSAM-----VREIE-EVV-------------V--------------
A0A2I3HW02_BCL2L11      FNHYLSAM-----DEAAG-SSL--------------------EVQWPFEW
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----DEATG-SSL---------------ALR-REVQCPLEW
A0A2K5HZI7_BCL2L11      FNHYLSAM-----DEATG-SSL-------------RIALH-REVQ-----
A0A2K5NU92_BCL2L11      FNHYLSAM-----DEATG-SSL-------------RIALH-REVQWPLEC
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----DEATG-SSL-------------GIALH-REVQWPLEC
A0A2I2YQ13_BCL2L11      FNHYLSAM-----DDSAG-SSL-------------RIALH-REVQWPLEW
O43521_BCL2L11-23       FNHYLSAM-----DDSAG-SSL-------------RIALH-REVQWPLKW
A0A2R9CA99_BCL2L11      FNHYLSAM-----DDSAG-SSL-------------RIALH-REVQWPLKW
A0A2J8JCT2_BCL2L11      FNHYLSAM-----DDSAG-SSL-------------RIALH-REVQWPLKW
F7HHA9_BCL2L11-07       FNHYLSAM-----DEATG-SSL-------------GIALH-REVQWPLEW
A0A2K5CAB2_BCL2L11      FNHYLSAM-----DEATE-SSL-------------GIALR-REVQWPLEW
A0A2K5X2I7_BCL2L11      FNHYLSAM-----DEATG-SSL-------------GIALH-REVQWPLEW
A0A2I3M6I1_BCL2L11      FNHYLSAM-----DEATG-SSL-------------GIALH-REVQWPLEW
C1KGB8_BCL2L11-01       -------------ASMRQSQAE-------------PADMR-PEIWIAQEL
A0A2K6GE31_BCL2L11      -------------ASMRQFQAE-------------PADMR-PEIWIAQEL
A0A337SW42_BCL2L11      -------------ASMRQPQAV-------------PADMR-PEIWIAQEL
O43521_BCL2L11-10       -------------ASMRQAE---------------PADMR-PEIWIAQEL
O43521_BCL2L11-20       -------------ASMRQAE---------------PADMR-PEIWIAQEL
A0A2I2YQ13_BCL2L11      -------------ASMRQAE---------------PADMR-PEIWIAQEL
O43521_BCL2L11-17       -------------ASMRQAE---------------PADMR-PEIWIAQEL
O43521_BCL2L11-13       -------------ASMRQAE---------------PADMR-PEIWIAQEL
A0A2I3HW02_BCL2L11      -------------ASMRQAE---------------PADMR-PEIWIAQEL
A0A2R9CA99_BCL2L11      -------------ASMRQAE---------------PADMR-PEIWIAQEL
A0A2J8JCT2_BCL2L11      -------------ASMRQAE---------------PADMR-PEIWIAQEL
A0A2K5NU92_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K5X2I7_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
F7HHA9_BCL2L11-05       -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K5Z8B6_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K5HZI7_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K6QIL2_BCL2L11      -------------ASRRQAE---------------PADMR-PEIRIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM------------GD-------------ISLWF-RFIFTFFDL
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----VVILEDIGD-------------SSL-F-GFIFTGLDL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----VVILEDIGD-------------TSLWF-GFIFTGLDL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----VVILEDIGD-------------TSLWF-GFIFTGLDL
F6XMC1_BCL2L11-09       FNHYLSAM-----VVIRMDIGD-------------ISLWF-RFTFTFFDL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----VVIRMDIGD-------------ISLWF-RFIFTFFDL
A0A2K5HZI7_BCL2L11      FNHYLSAM-----VVILEDIGD-------------TSLWF-GFIFTGLDL
A0A2R9CA99_BCL2L11      FNHYLSAM-----VVILEDIGD-------------LSLCF-GFIFTGLDL
A0A2J8JCT2_BCL2L11      FNHYLSAM-----VVILEDIGD-------------LSLCF-GFIFTGLDL
A0A2K5NU92_BCL2L11      FNHYLSAM-----VVILEDIGD-------------SSLWF-GFIFTGLDL
A0A2K5X2I7_BCL2L11      FNHYLSAM-----VVILEDIGD-------------SSLWF-GFIFTGLDL
F7HHA9_BCL2L11-09       FNHYLSAM-----VVILEDIGD-------------SSLWF-GFIFTGLDL
A0A2K6E226_BCL2L11      FNHYLSAM-----VVILEDIGD-------------SSLWF-GFIFTGLDL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----VVILEDIGD-------------SSLWF-GFIFTGLDL
A0A2I2YQ13_BCL2L11      FNHYLSAM-----VVILEDIGD-------------LSLWF-GFIFTGLDL
O43521_BCL2L11-06       FNHYLSAM-----VVILEDIGD-------------LSLCF-GFIFTGLDL
O43521_BCL2L11-15       FNHYLSAM-----VVILEDIGD-------------LSLCF-GFIFTGLDL
A0A2I3HW02_BCL2L11      FNHYLSAM-----VVILEDVGD-------------ISLWF-GFIFTGLDL
F1SU81_BCL2L11-03       FNHYLSAM-----ASMRQSQAE-------------PADMR-PEIWIAQEL
A0A0D9RWE0_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
O43521_BCL2L11-05       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-25       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O54918_BCL2L11-05       FNHYLSAM-----ASIRQSQEE-------------PEDLR-PEIRIAQEL
O88498_BCL2L11-02       FNHYLSAM-----ASIRQSQEE-------------PEDLR-PEIRIAQEL
A0A2K6GE31_BCL2L11      FNHYLSAM-----ASMRQFQAE-------------PADMR-PEIWIAQEL
A0A286XJN2_BCL2L11      FNHYLSAM-----ASMRQSQAG-------------PPHLR-PEIWIAQEL
A0A337SW42_BCL2L11      FNHYLSAM-----ASMRQPQAV-------------PADMR-PEIWIAQEL
A0A2K5CAB2_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6TRZ5_BCL2L11      FNHYLSAM-----ASMRQSQAE-------------PAGMR-PEIWIAQEL
A0A2K6QIL2_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5NU92_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5HZI7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5X2I7_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6E226_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K5Z8B6_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I3M6I1_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2K6KJP8_BCL2L11      FNHYLSAM-----ASRR--QAE-------------PADMR-PEIRIAQEL
A0A2I2YQ13_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
O43521_BCL2L11-02       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2R9CA99_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
A0A2J8JCT2_BCL2L11      FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
H2P5E2_BCL2L11-01       FNHYLSAM-----ASMR--QAE-------------PADMR-PEIWIAQEL
Q2YDF0_BCL2L11-01       FNHYLSAM-----ASMRQSQAV-------------PADTR-PEIWIAQEL
Q2YDF0_BCL2L11-03       FNHYLSAM-----ASMRQSQAV-------------PADTR-PEIWIAQEL
A0A287DFJ0_BCL2L11      FNHYLSAM-----ASMRESQAE-------------PADMR-PEIWIAQEL
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       RRIGDEFNASY-CPRRGFLDNH---AGNPQVVILRLLHYIIRLIWRMQ--
G1PDJ5_BCL2L11-01       RRIGDEFNNSYRNPRRDFLNVYREAEGHPQMVVLRLLRYILRLVWRRM--
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       RRIGDEFNASHCPRRGFL-------DYQAVNHQIIILRLLHYIVRFIWRM
A0A3B1JXK6_BCL2L11      RRIGDEFNDLYF------RGAGR-NGGGAQLPAQNEPAFILWMGLLIERL
A0A3B4BVX1_BCL2L11      RRIGDEFNELYF------HGVSQLHGCVAGMQALSNPVAFSILGLF----
A0A3B4BVX1_BCL2L11      RRIGDEFNELYF-------HGVSQLHGCVAGMQ----------ALSARDL
A0A3B4BVX1_BCL2L11      RRIGDEFNELYF-------HGAGRNGGRVQLPAEEEPAFMLWLGLVIRRL
W5UEE7_BCL2L11-01       RRIGDEFNQLYF-------HEAERNGGAARPQAQNEPAIMLWIGLLIGRL
A0A3B4V919_BCL2L11      ----GELKPALL---KHTKMTSQCCQTHFC--------------------
A0A3B4XZH1_BCL2L11      RRIGDDFNRLLL---LRVSHHRWCVCVCVCVCACGCVCACGCVCGCVRVC
A0A3B3VNE0_BCL2L11      RAIGDDYNNHLMVRRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLV
A0A3B3YII5_BCL2L11      RAIGDDYNNHLM--RMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLV
A0A3B3YII5_BCL2L11      RAIGDDYNNHLM--RMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLV
A0A3B5M375_BCL2L11      ------------------------IAVNIGPVLFIRPIPML-VPIYHAST
A0A3B5QAM1_BCL2L11      RAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLV
A0A3B5QAM1_BCL2L11      RAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLV
B2KKY9_BCL2L11-01       RRIGDEFNRLYCEAGAGVNQLRAPNEHAIVLWMNVIIGRLVHFFLRRR--
B8JK68_BCL2L11-01       RRIGDEFNRLYCEAGAGVNQLHAPNEHAIVLWMNDIIGRLVHFFLRRR--
A0A3B3QC78_BCL2L11      RRIGDKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYPGDNKNKESPL
K7GA86_BCL2L11-01       RRIGDEFNASYCPRRGFL--------DNQAINHQIVLRLLHYIIRLIWRM
G3SU55_BCL2L11-01       RRIGDEFNA-YYPRRAFL-NNYQAAEDHPQMVILRLLRYIVRLVWR----
G3W979_BCL2L11-01       RRIGDEFNA-SYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVWRMQ--
Q4KMV9_BCL2L11-01       RRIGDDFNASFSPRRGIF-NNLPRPLDNDQVIILRVLRFIIRLILRL---
F7FTC8_BCL2L11-01       RRIGDEFNASYCPRRGLL-DNNNPAGNNHQMGFVHLLRYIIRRVWRLQ--
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
M3YDI3_BCL2L11-01       RRIGDEFNA-YYPRRVFL-NNYPAAEAH---PQMIILRLLRYIIRLVWRL
F6XMC1_BCL2L11-02       RRIGDEFNA-YYPRRVNW-ILPFCHRKEVCLEAFPVLPSKASQSAYWTTI
F6XMC1_BCL2L11-01       RRIGDEFNA-YYPRRVNW-ILPFCHRKEVCLEAFPVLPSKASQSAYWTTI
F7CXT2_BCL2L11-01       RRIGDEFNASYYPRRGFL-DNNYQGAGDH--HQMVILRLLRYIIRLVWRM
O54918_BCL2L11-01       RRIGDEFNE-TYTRRVFA-NDYREAEDH---PQMVILQLLRFIFRLVWRR
O88498_BCL2L11-01       RRIGDEFNE-TYTRRAFA-NDYREAEDH---PQMVILQLLRFIFRLVWRR
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       RVNPHTWET-FKSTRTHS-LSARNSIHP----------------------
A0A2K6GE31_BCL2L11      RRIGDEFNA-YYPRRMPL-PSD----------------------------
A0A2K6GE31_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQADEDH---PQMLILRLLRYIVRLVWRR
A0A287DFJ0_BCL2L11      RRIGDEFNL-YYPRRVFF-NNYQPEDR----PQMVILRLLRCIIRLVWRM
A0A286XJN2_BCL2L11      RRIGDEFNA-SYPRRVFL-NHYQPAEDQ---PQMVILRLLRYIIRLVWRM
A0A286XJN2_BCL2L11      RRIGDEFNA-SYPRRVFL-NHYQPAEDQ---PQMVILRLLRYIIRLVWRM
A0A2K5CAB2_BCL2L11      RRIGDEFNA-YYPRRLEK--------------------------------
F6XMC1_BCL2L11-07       RRIGDEFNA-YYPRRLEK--------------------------------
A0A2K6TRZ5_BCL2L11      RRIGDEFNA-YYPRRLEK--------------------------------
F6XMC1_BCL2L11-05       RRIGDEFNA-YYPRRISL-LPD----------------------------
A0A2K6TRZ5_BCL2L11      RRIGDEFNA-YYPRRISL-PPD----------------------------
A0A2K5CAB2_BCL2L11      RRIGDEFNA-YYPRRISL-PSD----------------------------
A0A2K5NU92_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K5HZI7_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K5X2I7_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
F7HHA9_BCL2L11-02       RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K5Z8B6_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2I3M6I1_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRMSL-PPD----------------------------
A0A2I2YQ13_BCL2L11      RRIGDEFNA-YYARRMPL-PPD----------------------------
O43521_BCL2L11-16       RRIGDEFNA-YYARRMPL-PPD----------------------------
O43521_BCL2L11-09       RRIGDEFNA-YYARRMPL-PPD----------------------------
A0A2R9CA99_BCL2L11      RRIGDEFNA-YYARRMPL-PPD----------------------------
A0A2J8JCT2_BCL2L11      RRIGDEFNA-YYARRMPL-PPD----------------------------
A0A2K5NU92_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K5HZI7_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K5X2I7_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
F7HHA9_BCL2L11-04       RRIGDEFNA-YYARRLEK--------------------------------
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K5Z8B6_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2I3M6I1_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2I2YQ13_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
O43521_BCL2L11-18       RRIGDEFNA-YYARRLEK--------------------------------
A0A2I3HW02_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2R9CA99_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2J8JCT2_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
A0A2K5CAB2_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDH---PHMVILRLLRYIVRLVWRM
A0A2K5CAB2_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDH---PHMVILRLLRYIVRLVWRM
F6XMC1_BCL2L11-03       RRIGDEFNA-YYPRRVFL-NNYQAAEDH---PHMVILRLLRYIVRLVWRM
A0A2K6TRZ5_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDH---PHMVILRLLRYIVRLVWRM
A0A2K6TRZ5_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDH---PHMVILRLLRYIVRLVWRM
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEEH---PQMVILRLLRYIVRLVWRM
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEEH---PQMVILRLLRYIVRLVWRM
A0A2K5NU92_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K5HZI7_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K5X2I7_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K5Z8B6_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2I3M6I1_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PQMVILRLLRYIVRLVWRM
A0A2I2YQ13_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PRMVILRLLRYIVRLVWRM
O43521_BCL2L11-03       RRIGDEFNA-YYARRVFL-NNYQAAEDH---PRMVILRLLRYIVRLVWRM
A0A2I3HW02_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PRMVILRLLRYIVRLVWRM
A0A2R9CA99_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PRMVILRLLRYIVRLVWRM
A0A2J8JCT2_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDH---PRMVILRLLRYIVRLVWRM
F1SU81_BCL2L11-02       RRIGDEFNA-YYPRRVML-FSLPPFSPHTLPPPYI---------------
A0A337SW42_BCL2L11      RRIGDEFNA-YYPRRLEQ--------------------------------
Q2YDF0_BCL2L11-02       RRIGDEFNA-YYPRRVFV-R-HQAVEGH---PQMVLLRVLRYIVRLVWRM
W5PY58_BCL2L11-01       RRIGDEFNA-YYPRRVFV-R-HQAIEGH---PQMVLLRVLRYLVRLVWRM
G1SSY0_BCL2L11-01       RRIGDEFNA-YYPRRVFL-NNYPAAEEQ---PQMVILRLLRYIVRLVWRM
H0XW23_BCL2L11-01       RRIGDEFNA-YYPTRVFL-HNYQAAEDH---PQMVILRLLRYIVRLVWRL
A0A337SW42_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEAQ---PQMIILRLLRYIVRLVWRL
G1LDR8_BCL2L11-01       RRIGDEFNA-YYPRRVFL-NNYQAAEAH---PQMIILRLLRYIVRLVWRL
J9NWV6_BCL2L11-01       RRIGDEFNA-YYPRRVFL-NNYQAAEAH---PQMIILRLLRYIVRLVWRL
F1SU81_BCL2L11-01       RRIGDEFNA-YYPRRVFL-NNYQAAEAH---PQMVILRLLRYIARLVWRM
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       RRIGDEFNE-TYTRRVFA-NDYREAEDHPQMVILQLLRFIFRLVWRRH--
O54918_BCL2L11-06       RRIGDEFNE-TYTRRVFA-NDYREAEDHPQMVILQLLRFIFRLVWRRH--
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      LAKSS---------------------------------------------
A0A2K6TRZ5_BCL2L11      LAKSS---------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      LASS----------------------------------------------
A0A2K5Z8B6_BCL2L11      LASS----------------------------------------------
A0A2I2YQ13_BCL2L11      LAKSS---------------------------------------------
O43521_BCL2L11-23       LAKSS---------------------------------------------
A0A2R9CA99_BCL2L11      LAKSS---------------------------------------------
A0A2J8JCT2_BCL2L11      LAKSS---------------------------------------------
F7HHA9_BCL2L11-07       LA------------------------------------------------
A0A2K5CAB2_BCL2L11      LAKSS---------------------------------------------
A0A2K5X2I7_BCL2L11      LASS----------------------------------------------
A0A2I3M6I1_BCL2L11      LASS----------------------------------------------
C1KGB8_BCL2L11-01       RRIGDEFNA-YYPRRVML-FSLPPFSPHTLPPPYI---------------
A0A2K6GE31_BCL2L11      RRIGDEFNA-YYPRRLAK-CLVPSI-------------------------
A0A337SW42_BCL2L11      RRIGDEFNA-YYPRRLAR-VPASYI-------------------------
O43521_BCL2L11-10       RRIGDEFNA-YYARRMPL-PPD----------------------------
O43521_BCL2L11-20       RRIGDEFNA-YYARRMPL-PPD----------------------------
A0A2I2YQ13_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
O43521_BCL2L11-17       RRIGDEFNA-YYARRLAK-LLASST-------------------------
O43521_BCL2L11-13       RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2I3HW02_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2R9CA99_BCL2L11      RRIGDEFNA-YYARRLAK-LLSST--------------------------
A0A2J8JCT2_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2K5NU92_BCL2L11      RRIGDEFNA-YYARRLAE-LLASST-------------------------
A0A2K5X2I7_BCL2L11      RRIGDEFNA-YYARRLAE-LLASST-------------------------
F7HHA9_BCL2L11-05       RRIGDEFNA-YYARRLAE-LLASST-------------------------
A0A2K5Z8B6_BCL2L11      RRIGDEFNA-YYARRLAE-LLASST-------------------------
A0A2K5HZI7_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRLAK-LLASST-------------------------
A0A2K5CAB2_BCL2L11      YG-----HH-HSQGTEQL-HHKYFS-------------------------
A0A2K5Z8B6_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2K6KJP8_BCL2L11      YVVWIYIYH-HSQDTEQL-NHRDFS-------------------------
A0A2K6QIL2_BCL2L11      YVVWIYIYH-HSQDTEQL-NHRDFS-------------------------
F6XMC1_BCL2L11-09       CG-----HH-HSQGTEQQ-HKDFSW-------------------------
A0A2K6TRZ5_BCL2L11      YG-----YH-HSQGTEQL-HHKYVS-------------------------
A0A2K5HZI7_BCL2L11      YG-----HH-HSQDTEQL-NHRDFS-------------------------
A0A2R9CA99_BCL2L11      YG-----HH-HSQDAEQL-NHKDFS-------------------------
A0A2J8JCT2_BCL2L11      YG-----HH-HSQDAEQL-NHKDFS-------------------------
A0A2K5NU92_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2K5X2I7_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
F7HHA9_BCL2L11-09       YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2K6E226_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2I3M6I1_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2I2YQ13_BCL2L11      YG-----HH-HSQDTEQL-NHKDFS-------------------------
O43521_BCL2L11-06       YG-----HH-HSQDTEQL-NHKDFS-------------------------
O43521_BCL2L11-15       YG-----HH-HSQDTEQL-NHKDFS-------------------------
A0A2I3HW02_BCL2L11      YG-----HH-HSQDTEQF-NHKDFS-------------------------
F1SU81_BCL2L11-03       RRIGDEFNA-YYPRRVML-FSLPPFSPHTLPPPYI---------------
A0A0D9RWE0_BCL2L11      RRIGDEFNA-YYARRLEK--------------------------------
O43521_BCL2L11-05       RRIGDEFNA-YYARRLEK--------------------------------
O43521_BCL2L11-25       RRIGDEFNA-YYARRLEK--------------------------------
O54918_BCL2L11-05       RRIGDEFNE-TYTRRVFA-NDYREAEDHPQMVILQLLRFIFRLVWRRH--
O88498_BCL2L11-02       RRIGDEFNE-TYTRRAFA-NDYREAEDHPQMVILQLLRFIFRLVWRRH--
A0A2K6GE31_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQADEDHPQMLILRLLRYIVRLVWRRH--
A0A286XJN2_BCL2L11      RRIGDEFNA-SYPRRVFL-NHYQPAEDQPQMVILRLLRYIIRLVWRMH--
A0A337SW42_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEAQPQMIILRLLRYIVRLVWRLQ--
A0A2K5CAB2_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDHPHMVILRLLRYIVRLVWRMH--
A0A2K6TRZ5_BCL2L11      RRIGDEFNA-YYPRRVFL-NNYQAAEDHPHMVILRLLRYIVRLVWRMH--
A0A2K6QIL2_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEEHPQMVILRLLRYIVRLVWRMH--
A0A2K5NU92_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K5HZI7_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K5X2I7_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6E226_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K5Z8B6_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2I3M6I1_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2I3M6I1_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2K6KJP8_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPQMVILRLLRYIVRLVWRMH--
A0A2I2YQ13_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPRMVILRLLRYIVRLVWRMH--
O43521_BCL2L11-02       RRIGDEFNA-YYARRVFL-NNYQAAEDHPRMVILRLLRYIVRLVWRMH--
A0A2R9CA99_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPRMVILRLLRYIVRLVWRMH--
A0A2J8JCT2_BCL2L11      RRIGDEFNA-YYARRVFL-NNYQAAEDHPRMVILRLLRYIVRLVWRMH--
H2P5E2_BCL2L11-01       RRIGDEFNA-YYARRVFL-NNYQAAEDHPRMVILRLLRYIVRLVWRMH--
Q2YDF0_BCL2L11-01       RRIGDEFNA-YYPRRVFV-RH-QAVEGHPQMVLLRVLRYIVRLVWRMQ--
Q2YDF0_BCL2L11-03       RRIGDEFNA-YYPRRVFV-RH-QAVEGHPQMVLLRVLRYIVRLVWRMQ--
A0A287DFJ0_BCL2L11      RRIGDEFNL-YYPRRVFF-NN-YQPEDRPQMVILRLLRCIIRLVWRMH--
                                                                          

U3IW89_BCL2L11-01       --------------------------------------------------
Q6JTU4_BCL2L11-01       --------------------------------------------------
G1MV54_BCL2L11-01       --------------------------------------------------
G1PDJ5_BCL2L11-01       --------------------------------------------------
M3XHJ5_BCL2L11-01       --------------------------------------------------
R4G9R5_BCL2L11-01       Q-------------------------------------------------
A0A3B1JXK6_BCL2L11      RQFLHRRR------------------------------------------
A0A3B4BVX1_BCL2L11      -----RGH------------------------------------------
A0A3B4BVX1_BCL2L11      HDQMFALS------------------------------------------
A0A3B4BVX1_BCL2L11      LEVLLRRR------------------------------------------
W5UEE7_BCL2L11-01       LQFFLRQR------------------------------------------
A0A3B4V919_BCL2L11      --------------------------------------------------
A0A3B4XZH1_BCL2L11      GGGGGVE-------------------------------------------
A0A3B3VNE0_BCL2L11      GRIMYMQGNTSSHDHSQV--------------------------------
A0A3B3YII5_BCL2L11      GRIMYMQGNTSSHDHSQV--------------------------------
A0A3B3YII5_BCL2L11      GRIMYMQGNTSSHDHSQV--------------------------------
A0A3B5M375_BCL2L11      LRISALE-------------------------------------------
A0A3B5QAM1_BCL2L11      GRIMYMQGNTSSHDHSQV--------------------------------
A0A3B5QAM1_BCL2L11      GRIMYMQGNTSSHDHSQV--------------------------------
B2KKY9_BCL2L11-01       --------------------------------------------------
B8JK68_BCL2L11-01       --------------------------------------------------
A0A3B3QC78_BCL2L11      RSRSSWLHVRMGEVEQQEIV------------------------------
K7GA86_BCL2L11-01       Q-------------------------------------------------
G3SU55_BCL2L11-01       --------------------------------------------------
G3W979_BCL2L11-01       --------------------------------------------------
Q4KMV9_BCL2L11-01       --------------------------------------------------
F7FTC8_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
M3YDI3_BCL2L11-01       Q-------------------------------------------------
F6XMC1_BCL2L11-02       RDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVKSA
F6XMC1_BCL2L11-01       RDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYLVLKDGGPVVKSA
F7CXT2_BCL2L11-01       Q-------------------------------------------------
O54918_BCL2L11-01       H-------------------------------------------------
O88498_BCL2L11-01       H-------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-22       --------------------------------------------------
O43521_BCL2L11-08       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-03       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-06       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-04       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-24       --------------------------------------------------
O43521_BCL2L11-12       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-06       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-21       --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-01       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-08       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      H-------------------------------------------------
A0A287DFJ0_BCL2L11      H-------------------------------------------------
A0A286XJN2_BCL2L11      H-------------------------------------------------
A0A286XJN2_BCL2L11      H-------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-07       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-05       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-02       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-16       --------------------------------------------------
O43521_BCL2L11-09       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-04       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-18       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      H-------------------------------------------------
A0A2K5CAB2_BCL2L11      H-------------------------------------------------
F6XMC1_BCL2L11-03       H-------------------------------------------------
A0A2K6TRZ5_BCL2L11      H-------------------------------------------------
A0A2K6TRZ5_BCL2L11      H-------------------------------------------------
A0A2K6QIL2_BCL2L11      H-------------------------------------------------
A0A2K6QIL2_BCL2L11      H-------------------------------------------------
A0A2K5NU92_BCL2L11      H-------------------------------------------------
A0A2K5HZI7_BCL2L11      H-------------------------------------------------
A0A2K5X2I7_BCL2L11      H-------------------------------------------------
A0A2K6E226_BCL2L11      H-------------------------------------------------
A0A2K6E226_BCL2L11      H-------------------------------------------------
A0A2K5Z8B6_BCL2L11      H-------------------------------------------------
A0A2I3M6I1_BCL2L11      H-------------------------------------------------
A0A2K6KJP8_BCL2L11      H-------------------------------------------------
A0A2K6KJP8_BCL2L11      H-------------------------------------------------
A0A2I2YQ13_BCL2L11      H-------------------------------------------------
O43521_BCL2L11-03       H-------------------------------------------------
A0A2I3HW02_BCL2L11      H-------------------------------------------------
A0A2R9CA99_BCL2L11      H-------------------------------------------------
A0A2J8JCT2_BCL2L11      H-------------------------------------------------
F1SU81_BCL2L11-02       --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
Q2YDF0_BCL2L11-02       Q-------------------------------------------------
W5PY58_BCL2L11-01       Q-------------------------------------------------
G1SSY0_BCL2L11-01       H-------------------------------------------------
H0XW23_BCL2L11-01       H-------------------------------------------------
A0A337SW42_BCL2L11      Q-------------------------------------------------
G1LDR8_BCL2L11-01       Q-------------------------------------------------
J9NWV6_BCL2L11-01       Q-------------------------------------------------
F1SU81_BCL2L11-01       Q-------------------------------------------------
O43521_BCL2L11-11       --------------------------------------------------
F7HHA9_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-08       --------------------------------------------------
O54918_BCL2L11-06       --------------------------------------------------
O54918_BCL2L11-03       --------------------------------------------------
O43521_BCL2L11-07       --------------------------------------------------
O43521_BCL2L11-19       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-23       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-07       --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
O43521_BCL2L11-10       --------------------------------------------------
O43521_BCL2L11-20       --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-17       --------------------------------------------------
O43521_BCL2L11-13       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-05       --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
F6XMC1_BCL2L11-09       --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
F7HHA9_BCL2L11-09       --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-06       --------------------------------------------------
O43521_BCL2L11-15       --------------------------------------------------
A0A2I3HW02_BCL2L11      --------------------------------------------------
F1SU81_BCL2L11-03       --------------------------------------------------
A0A0D9RWE0_BCL2L11      --------------------------------------------------
O43521_BCL2L11-05       --------------------------------------------------
O43521_BCL2L11-25       --------------------------------------------------
O54918_BCL2L11-05       --------------------------------------------------
O88498_BCL2L11-02       --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A286XJN2_BCL2L11      --------------------------------------------------
A0A337SW42_BCL2L11      --------------------------------------------------
A0A2K5CAB2_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K5NU92_BCL2L11      --------------------------------------------------
A0A2K5HZI7_BCL2L11      --------------------------------------------------
A0A2K5X2I7_BCL2L11      --------------------------------------------------
A0A2K6E226_BCL2L11      --------------------------------------------------
A0A2K5Z8B6_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2I3M6I1_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2I2YQ13_BCL2L11      --------------------------------------------------
O43521_BCL2L11-02       --------------------------------------------------
A0A2R9CA99_BCL2L11      --------------------------------------------------
A0A2J8JCT2_BCL2L11      --------------------------------------------------
H2P5E2_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-01       --------------------------------------------------
Q2YDF0_BCL2L11-03       --------------------------------------------------
A0A287DFJ0_BCL2L11      --------------------------------------------------
                                                                          

U3IW89_BCL2L11-01       -----------
Q6JTU4_BCL2L11-01       -----------
G1MV54_BCL2L11-01       -----------
G1PDJ5_BCL2L11-01       -----------
M3XHJ5_BCL2L11-01       -----------
R4G9R5_BCL2L11-01       -----------
A0A3B1JXK6_BCL2L11      -----------
A0A3B4BVX1_BCL2L11      -----------
A0A3B4BVX1_BCL2L11      -----------
A0A3B4BVX1_BCL2L11      -----------
W5UEE7_BCL2L11-01       -----------
A0A3B4V919_BCL2L11      -----------
A0A3B4XZH1_BCL2L11      -----------
A0A3B3VNE0_BCL2L11      -----------
A0A3B3YII5_BCL2L11      -----------
A0A3B3YII5_BCL2L11      -----------
A0A3B5M375_BCL2L11      -----------
A0A3B5QAM1_BCL2L11      -----------
A0A3B5QAM1_BCL2L11      -----------
B2KKY9_BCL2L11-01       -----------
B8JK68_BCL2L11-01       -----------
A0A3B3QC78_BCL2L11      -----------
K7GA86_BCL2L11-01       -----------
G3SU55_BCL2L11-01       -----------
G3W979_BCL2L11-01       -----------
Q4KMV9_BCL2L11-01       -----------
F7FTC8_BCL2L11-01       -----------
A0A2K6E226_BCL2L11      -----------
M3YDI3_BCL2L11-01       -----------
F6XMC1_BCL2L11-02       LKLPWFHSPVA
F6XMC1_BCL2L11-01       LKLPWFHSPVA
F7CXT2_BCL2L11-01       -----------
O54918_BCL2L11-01       -----------
O88498_BCL2L11-01       -----------
A0A337SW42_BCL2L11      -----------
A0A337SW42_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-22       -----------
O43521_BCL2L11-08       -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-03       -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
F6XMC1_BCL2L11-06       -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
F6XMC1_BCL2L11-04       -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-24       -----------
O43521_BCL2L11-12       -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-06       -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-21       -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-01       -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K6GE31_BCL2L11      -----------
A0A2K6GE31_BCL2L11      -----------
F6XMC1_BCL2L11-08       -----------
A0A2K6GE31_BCL2L11      -----------
A0A2K6GE31_BCL2L11      -----------
A0A287DFJ0_BCL2L11      -----------
A0A286XJN2_BCL2L11      -----------
A0A286XJN2_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
F6XMC1_BCL2L11-07       -----------
A0A2K6TRZ5_BCL2L11      -----------
F6XMC1_BCL2L11-05       -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-02       -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-16       -----------
O43521_BCL2L11-09       -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-04       -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-18       -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
F6XMC1_BCL2L11-03       -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-03       -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
F1SU81_BCL2L11-02       -----------
A0A337SW42_BCL2L11      -----------
Q2YDF0_BCL2L11-02       -----------
W5PY58_BCL2L11-01       -----------
G1SSY0_BCL2L11-01       -----------
H0XW23_BCL2L11-01       -----------
A0A337SW42_BCL2L11      -----------
G1LDR8_BCL2L11-01       -----------
J9NWV6_BCL2L11-01       -----------
F1SU81_BCL2L11-01       -----------
O43521_BCL2L11-11       -----------
F7HHA9_BCL2L11-08       -----------
O54918_BCL2L11-08       -----------
O54918_BCL2L11-06       -----------
O54918_BCL2L11-03       -----------
O43521_BCL2L11-07       -----------
O43521_BCL2L11-19       -----------
A0A2I3HW02_BCL2L11      -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-23       -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
F7HHA9_BCL2L11-07       -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
C1KGB8_BCL2L11-01       -----------
A0A2K6GE31_BCL2L11      -----------
A0A337SW42_BCL2L11      -----------
O43521_BCL2L11-10       -----------
O43521_BCL2L11-20       -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-17       -----------
O43521_BCL2L11-13       -----------
A0A2I3HW02_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-05       -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
F6XMC1_BCL2L11-09       -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
F7HHA9_BCL2L11-09       -----------
A0A2K6E226_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-06       -----------
O43521_BCL2L11-15       -----------
A0A2I3HW02_BCL2L11      -----------
F1SU81_BCL2L11-03       -----------
A0A0D9RWE0_BCL2L11      -----------
O43521_BCL2L11-05       -----------
O43521_BCL2L11-25       -----------
O54918_BCL2L11-05       -----------
O88498_BCL2L11-02       -----------
A0A2K6GE31_BCL2L11      -----------
A0A286XJN2_BCL2L11      -----------
A0A337SW42_BCL2L11      -----------
A0A2K5CAB2_BCL2L11      -----------
A0A2K6TRZ5_BCL2L11      -----------
A0A2K6QIL2_BCL2L11      -----------
A0A2K5NU92_BCL2L11      -----------
A0A2K5HZI7_BCL2L11      -----------
A0A2K5X2I7_BCL2L11      -----------
A0A2K6E226_BCL2L11      -----------
A0A2K5Z8B6_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2I3M6I1_BCL2L11      -----------
A0A2K6KJP8_BCL2L11      -----------
A0A2I2YQ13_BCL2L11      -----------
O43521_BCL2L11-02       -----------
A0A2R9CA99_BCL2L11      -----------
A0A2J8JCT2_BCL2L11      -----------
H2P5E2_BCL2L11-01       -----------
Q2YDF0_BCL2L11-01       -----------
Q2YDF0_BCL2L11-03       -----------
A0A287DFJ0_BCL2L11      -----------
                                   

© 1998-2019