Dataset for protein Puma of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

38 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALAS
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          PNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWE
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          PAAQDTCVRPAGATAGAGAGAVASGGGDRGGGSSSSSSSSSSSSSSRGSS
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          RGSGGEQAARSQAPPGRPGPRLTAPQARPRRRVHAPGGLGVGLRSGECAP
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          RLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSAHLS
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          VSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          -----------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          -----------MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGL
M3Y0R3_BBC3-01          -----QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGL
Q99ML1_BBC3-02          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSL
Q80ZG6_BBC3-01          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGL
H0XQ00_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A3Q2GWE8_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A3Q1LXZ6_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A452E3G1_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
J9NTK9_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A337SQV0_BBC3-02      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
F1RM01_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A2K6FQZ3_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
Q9BXH1_BBC3-06          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2I3RGH5_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
H2NZD3_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2K6QZU4_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A0D9S2H2_BBC3-01      -----QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
B4DQK3_BBC3-01          -----MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          CEAGLNPSGDSMCPAPGPALAP--SSLLPLAYFCTRQPRAYGGPRWARAA
Q9BXH1_BBC3-03          MKFGMGSA------QACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQL
A0A2K5F6X4_BBC3-02      -KCGVGSA------WACPCQVPRASSSTWVPCQM----------------
A0A337SQV0_BBC3-03      YLGGGGLG------ESCVCARARCVGVTPWVCVA----------------
Q9BXH1_BBC3-04          MKFGMGSA------QACPCQVPRAASTTWVPCQI----------------
K7E5Y2_BBC3-02          CEAGLNPSGDSMCPAPGPALAP--SSLLPLAYFCTRQPRAYGGPRWARAA
A0A2I3HWI8_BBC3-03      MKFGMGSA------RACPCQVPRASSVTWVPCQI----------------
A0A2K6FQZ3_BBC3-04      MKFGAGSA------RACPCQVPGTSFSWWVLGHI----------------
Q9BXH1_BBC3-05          MKFGMGSA------QACPCQVPRAASTTWVPCQI----------------
A0A2R9BZA9_BBC3-01      MKFGMGSA------QACPCQVPRAASVTWVPCQI----------------
A0A2I3RGH5_BBC3-03      MKFGMGSA------QACPCQVPRAASATWVPCQI----------------
A0A2K5P2T8_BBC3-03      IKFGVGSA------RACPCQVPRAASATWVLCQI----------------
A0A2K5V8J3_BBC3-03      IKFGVGSA------RACPCQVPRASSATWVPCQI----------------
F7FFP6_BBC3-03          IKFGVGSA------RACPCQVPRASSATWVPCQI----------------
A0A2K6ASP2_BBC3-03      IKFGVGSA------RACPCQVPRASSATWVPCQI----------------
A0A2I3N2Z9_BBC3-03      IKFGVGSA------RACPCQVPRASSATWVPCQI----------------
A0A2K6QZU4_BBC3-04      IKFGVGSA------RACPCQVPRASSATWVPCQI----------------
A0A2R8MW85_BBC3-03      MKCGVGSA------WACPCQVPRASSSVWVPCQM----------------
A0A2K6STD6_BBC3-02      MKCGMGSA------WACPCQVPRASSLTWVPCQM----------------
G3T2N1_BBC3-01          CEPGLPRV-------AGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERGGA
M3Y0R3_BBC3-01          WESDCSPR------VAAHGLFRAGAAAVSQPPPPPVWVSLTSQRTIVGGS
Q99ML1_BBC3-02          CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGH
Q80ZG6_BBC3-01          CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGH
H0XQ00_BBC3-01          CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTATLGGPRWPGGP
A0A3Q2GWE8_BBC3-01      CEPGLPAA------PAAPALLP--AAYLCAPAAPPAVTAALGGPRWPGGP
A0A3Q1LXZ6_BBC3-01      CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGAPRWPGGP
A0A452E3G1_BBC3-01      CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGAPRWPGGP
J9NTK9_BBC3-01          CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
A0A337SQV0_BBC3-02      CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
F1RM01_BBC3-01          CEPGLPAA------PAAPTLLP--AAYLCAPTAPPAVTAALGGPRWPGGP
A0A2K6FQZ3_BBC3-01      CEPGLPAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
Q9BXH1_BBC3-06          CEPGLAAA------PAAPTLLP--AAYLCAPTAPPAVTAALGGSRWPGGP
A0A2I3RGH5_BBC3-01      CEPGLAAA------PAAPTLLP--AAYLCAPTAPPAVTAALGGPRWPGGP
H2NZD3_BBC3-01          CEPGLAAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
A0A2K6QZU4_BBC3-01      CEPGLAAT------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
A0A0D9S2H2_BBC3-01      CEPGLAAA------PAAPALLP--AAYLCAPTAPPAVTAALGGPRWPGGP
B4DQK3_BBC3-01          CEPGLAAA------PAAPTLLP--AAYLCAPTAPPAVTAALGGSRWPGGP
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          RSPAAGNQGQ----------------------------------------
Q9BXH1_BBC3-03          PGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPL
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          RSPAAGNQGQ----------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          EWEDRAPRPL----------------------------------------
M3Y0R3_BBC3-01          VGRARGLLF-----------------------------------------
Q99ML1_BBC3-02          RSRPRGPRP-----------------------------------------
Q80ZG6_BBC3-01          RSRPRGPRP-----------------------------------------
H0XQ00_BBC3-01          RSRPRGPRL-----------------------------------------
A0A3Q2GWE8_BBC3-01      RSRPRAPRP-----------------------------------------
A0A3Q1LXZ6_BBC3-01      RSRPRGPRP-----------------------------------------
A0A452E3G1_BBC3-01      RSRPRGPRP-----------------------------------------
J9NTK9_BBC3-01          RSRPRGPRP-----------------------------------------
A0A337SQV0_BBC3-02      RSRPRGPRP-----------------------------------------
F1RM01_BBC3-01          RSRPRGPRP-----------------------------------------
A0A2K6FQZ3_BBC3-01      RSRPRGPRP-----------------------------------------
Q9BXH1_BBC3-06          RSRPRGPRP-----------------------------------------
A0A2I3RGH5_BBC3-01      RSRPRGPRP-----------------------------------------
H2NZD3_BBC3-01          RSRPRGPRP-----------------------------------------
A0A2K6QZU4_BBC3-01      RSRPRGPRP-----------------------------------------
A0A0D9S2H2_BBC3-01      RSRPRGPRP-----------------------------------------
B4DQK3_BBC3-01          RSRPRGPRP-----------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          ---------------------------------------SGSLPSLGPRS
Q9BXH1_BBC3-03          RPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQ
A0A2K5F6X4_BBC3-02      ---------------------------------------CGPQPSLSLAE
A0A337SQV0_BBC3-03      ---------------------------------------C-PQPSLSPAE
Q9BXH1_BBC3-04          ---------------------------------------CETRGAAAAPP
K7E5Y2_BBC3-02          ---------------------------------------SGSLPSLGPRS
A0A2I3HWI8_BBC3-03      ---------------------------------------C----------
A0A2K6FQZ3_BBC3-04      ---------------------------------------PGPQPSLSLAE
Q9BXH1_BBC3-05          ---------------------------------------CGPQPSLSLAE
A0A2R9BZA9_BBC3-01      ---------------------------------------CGPQPSLSLAE
A0A2I3RGH5_BBC3-03      ---------------------------------------CGPQPSLSLAE
A0A2K5P2T8_BBC3-03      ---------------------------------------CGPQPSLLLAE
A0A2K5V8J3_BBC3-03      ---------------------------------------CGPQPSLLLAE
F7FFP6_BBC3-03          ---------------------------------------CGPQPSLLLAE
A0A2K6ASP2_BBC3-03      ---------------------------------------CGPQPSLLLAE
A0A2I3N2Z9_BBC3-03      ---------------------------------------CGPQPSLLLAE
A0A2K6QZU4_BBC3-04      ---------------------------------------CGPQPSLSLAE
A0A2R8MW85_BBC3-03      ---------------------------------------CGPQPSLSLAE
A0A2K6STD6_BBC3-02      ---------------------------------------CGSQPSLSLAE
G3T2N1_BBC3-01          ---------------------------------------SGPQPSLSPAE
M3Y0R3_BBC3-01          ---------------------------------------PGPQPSLSPAE
Q99ML1_BBC3-02          ---------------------------------------DGPQPSLSPAQ
Q80ZG6_BBC3-01          ---------------------------------------DGPQPSLSPAQ
H0XQ00_BBC3-01          ---------------------------------------DGPQPSLLPAE
A0A3Q2GWE8_BBC3-01      ---------------------------------------DGPQPSLLPAE
A0A3Q1LXZ6_BBC3-01      ---------------------------------------DGPQPSLSPAE
A0A452E3G1_BBC3-01      ---------------------------------------DGPQPSLSPAE
J9NTK9_BBC3-01          ---------------------------------------DGPQPSLSPAE
A0A337SQV0_BBC3-02      ---------------------------------------DGPQPSLSPAE
F1RM01_BBC3-01          ---------------------------------------DGPQPSLSPAE
A0A2K6FQZ3_BBC3-01      ---------------------------------------DGPQPSLSLAE
Q9BXH1_BBC3-06          ---------------------------------------DGPQPSLSLAE
A0A2I3RGH5_BBC3-01      ---------------------------------------DGPQPSLSLAE
H2NZD3_BBC3-01          ---------------------------------------DGPQPSLSLAE
A0A2K6QZU4_BBC3-01      ---------------------------------------DGPQPSLSLAE
A0A0D9S2H2_BBC3-01      ---------------------------------------DGPQPSLSLAE
B4DQK3_BBC3-01          ---------------------------------------DGPQPSLSLAE
                                                                          

A0A2K6KS56_BBC3-02      --LAERTWSRGASPGAL------AAPGVAGRR------RSGPGI------
K7E5Y2_BBC3-01          AQEEGGQEGEPQGASPMSGGP----PGVLGPEHGDQGEQQDREI------
Q9BXH1_BBC3-03          RPGGSGGRSHPGGPGSPRGGGT-VGPGDRGPA-AADGGRPQRTVRAAETR
A0A2K5F6X4_BBC3-02      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A337SQV0_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
Q9BXH1_BBC3-04          LTLEGPVQSHHGTP-ALTQGPQSPRDGA--------------QL------
K7E5Y2_BBC3-02          AQEEGGQEGEPQGASPMSGGP----PGVLGPEHGDQGEQQDREI------
A0A2I3HWI8_BBC3-03      -----------------AGGPTQAAPGVRGEE-----EQWAREI------
A0A2K6FQZ3_BBC3-04      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
Q9BXH1_BBC3-05          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2R9BZA9_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2I3RGH5_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K5P2T8_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K5V8J3_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
F7FFP6_BBC3-03          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K6ASP2_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2I3N2Z9_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K6QZU4_BBC3-04      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2R8MW85_BBC3-03      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K6STD6_BBC3-02      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
G3T2N1_BBC3-01          QHLESPV-------------PTQAAPGVRGED-----EQWAREI------
M3Y0R3_BBC3-01          PHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
Q99ML1_BBC3-02          QHLESPV---PSAPEALAGGPTQAAPGVRVEE-----EEWAREI------
Q80ZG6_BBC3-01          QHLESPV---PSAPEALAGGPTQAAPGVRVEE-----EEWAREI------
H0XQ00_BBC3-01          QHLESPV---PSTPGALAGGPTQAAPEVRGEE-----EQWAREI------
A0A3Q2GWE8_BBC3-01      QHLESPV---PSAPGALEGGPTQAAPGVRGEE-----EQWAREI------
A0A3Q1LXZ6_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A452E3G1_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
J9NTK9_BBC3-01          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A337SQV0_BBC3-02      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
F1RM01_BBC3-01          QHLESPV---PSAPGALAGGPTQAAPGIRGEE-----EQWAREI------
A0A2K6FQZ3_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
Q9BXH1_BBC3-06          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2I3RGH5_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
H2NZD3_BBC3-01          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A2K6QZU4_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
A0A0D9S2H2_BBC3-01      QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAQEI------
B4DQK3_BBC3-01          QHLESPV---PSAPGALAGGPTQAAPGVRGEE-----EQWAREI------
                                                                   :      

A0A2K6KS56_BBC3-02      -------------------------GAQLRRMARRLNAQYRRR-RQEEQQ
K7E5Y2_BBC3-01          -------------------------GAQLRRMADDLNALYEQR-RREEEQ
Q9BXH1_BBC3-03          GAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGG
A0A2K5F6X4_BBC3-02      -------------------------GAQLRRMADDLNAQYERR-RQEEQP
A0A337SQV0_BBC3-03      -------------------------GAQLRRMADDLNALYERR-RQEEQQ
Q9BXH1_BBC3-04          -------------------------GACTRPVD-----------VRDSGG
K7E5Y2_BBC3-02          -------------------------GAQLRRMADDLNALYEQR-RREEEQ
A0A2I3HWI8_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K6FQZ3_BBC3-04      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
Q9BXH1_BBC3-05          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2R9BZA9_BBC3-01      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2I3RGH5_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K5P2T8_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K5V8J3_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
F7FFP6_BBC3-03          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K6ASP2_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2I3N2Z9_BBC3-03      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K6QZU4_BBC3-04      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2R8MW85_BBC3-03      -------------------------GAQLRRMADDLNALYERR-RQEEQP
A0A2K6STD6_BBC3-02      -------------------------GAQLRRMADDLNAQYERR-RQEEQP
G3T2N1_BBC3-01          -------------------------GAQFRRKADDLYALYERSVRQEEQH
M3Y0R3_BBC3-01          -------------------------GAQLRRMADDLNALYERR-RQEEQQ
Q99ML1_BBC3-02          -------------------------GAQLRRMADDLNAQYERR-RQEEQH
Q80ZG6_BBC3-01          -------------------------GAQLRRMADDLNAQYERR-RQEEQH
H0XQ00_BBC3-01          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A3Q2GWE8_BBC3-01      -------------------------GAQLRRMADDLNALYERR-RQEEQQ
A0A3Q1LXZ6_BBC3-01      -------------------------GAQLRRMADDLNALYERR-RQEERQ
A0A452E3G1_BBC3-01      -------------------------GAQLRRMADDLNALYERR-RQEERQ
J9NTK9_BBC3-01          -------------------------GAQLRRMADDLNALYERR-RQEEQQ
A0A337SQV0_BBC3-02      -------------------------GAQLRRMADDLNALYERR-RQEEQQ
F1RM01_BBC3-01          -------------------------GAQLRRMADDLNALYERR-RQEEQQ
A0A2K6FQZ3_BBC3-01      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
Q9BXH1_BBC3-06          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2I3RGH5_BBC3-01      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
H2NZD3_BBC3-01          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A2K6QZU4_BBC3-01      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
A0A0D9S2H2_BBC3-01      -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
B4DQK3_BBC3-01          -------------------------GAQLRRMADDLNAQYERR-RQEEQQ
                                                 *.                  .:.  

A0A2K6KS56_BBC3-02      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
K7E5Y2_BBC3-01          RRHLSPWRLLY--NLISGLLAPQRRNRMPDVEPN
Q9BXH1_BBC3-03          RPLPPPDTLASAGDFLCTM---------------
A0A2K5F6X4_BBC3-02      QHRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN
A0A337SQV0_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRARGAPEMEPN
Q9BXH1_BBC3-04          RPLPPPDTLASAGDFLCTM---------------
K7E5Y2_BBC3-02          RRHLSPWRLLY--NLISGLLAPQRRNRMPDVEPN
A0A2I3HWI8_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K6FQZ3_BBC3-04      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-05          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2R9BZA9_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2I3RGH5_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K5P2T8_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K5V8J3_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
F7FFP6_BBC3-03          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K6ASP2_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2I3N2Z9_BBC3-03      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K6QZU4_BBC3-04      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2R8MW85_BBC3-03      QHRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN
A0A2K6STD6_BBC3-02      QHRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN
G3T2N1_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRDHGAPEMEPN
M3Y0R3_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN
Q99ML1_BBC3-02          RHRPSPWRVMY--NLFMGLLPLPRDPGAPEMEPN
Q80ZG6_BBC3-01          RHRPSPWRVMY--NLFMGLLPLPRDPGAPEMEPN
H0XQ00_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A3Q2GWE8_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGRAAPEMEPN
A0A3Q1LXZ6_BBC3-01      RHRPSPWRVLY--NLIMGLLPFPGGRGAPEVEPN
A0A452E3G1_BBC3-01      RHRPSPWRVLY--NLILGLLPFPGGRGAPEVEPN
J9NTK9_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN
A0A337SQV0_BBC3-02      RHRPSPWRVLY--NLIMGLLPLPRARGAPEMEPN
F1RM01_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN
A0A2K6FQZ3_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-06          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2I3RGH5_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
H2NZD3_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A2K6QZU4_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
A0A0D9S2H2_BBC3-01      RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
B4DQK3_BBC3-01          RHRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN
                        .   .*  :    :::  :               

© 1998-2019