Dataset for protein Puma of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

36 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          VRLGEAPGKPLSPGCGSGQRGPGGAGSGGAGRGGGSRSRRRSLSSPALAS
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          PNCLGADGCRRAGAGGGSGAGRSVTSRGSRGARLQREAAAAAAAAEPAWE
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          PAAQDTCVRPAGATAGAGAGAVASGGGDRGGGSSSSSSSSSSSSSSRGSS
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          RGSGGEQAARSQAPPGRPGPRLTAPQARPRRRVHAPGGLGVGLRSGECAP
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          RLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRGRARGVAPPLTCSAHLS
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
A0A337SQV0_BBC3-02      --------------------------------------------------
F1RM01_BBC3-01          --------------------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RIG5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          VSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
A0A337SQV0_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          -----------MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSL
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          -----------MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGL
M3Y0R3_BBC3-01          -----QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGL
Q99ML1_BBC3-02          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSL
Q80ZG6_BBC3-01          -----------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGL
H0XQ00_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
J9NTK9_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A337SQV0_BBC3-02      -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
F1RM01_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGL
A0A2K6FQZ3_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
Q9BXH1_BBC3-06          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2I3RIG5_BBC3-02      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
H2NZD3_BBC3-01          -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A2K6QZU4_BBC3-01      -----------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
A0A0D9S2H2_BBC3-01      -----QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
B4DQK3_BBC3-01          -----MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGL
                                                                          

A0A2K6KS56_BBC3-02      -------------------LAERTWSRGA---------------------
K7E5Y2_BBC3-01          CEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARS
A0A337SQV0_BBC3-01      VYLSAGAA--RACPRQVP--GASFFPGC------PRERHGPSTPGGQLPG
Q9BXH1_BBC3-03          MKFGMGSA--QACPCQVPRAASTTWVPCQ--ICGPRERHGPRTPGGQLPG
A0A2K5F6X4_BBC3-02      -KCGVGSA--WACPCQVPRASSSTWVPCQ--M------------------
A0A337SQV0_BBC3-03      YLGGGGLG--ESCVCARARCVGVTPWVCV--A------------------
Q9BXH1_BBC3-04          MKFGMGSA--QACPCQVPRAASTTWVPCQ--I------------------
K7E5Y2_BBC3-02          CEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARS
A0A2I3HWI8_BBC3-03      MKFGMGSA--RACPCQVPRASSVTWVPCQ--I------------------
A0A2K6FQZ3_BBC3-04      MKFGAGSA--RACPCQVPGTSFSWWVLGH--I------------------
Q9BXH1_BBC3-05          MKFGMGSA--QACPCQVPRAASTTWVPCQ--I------------------
A0A2R9BZA9_BBC3-01      MKFGMGSA--QACPCQVPRAASVTWVPCQ--I------------------
A0A2I3RGH5_BBC3-03      MKFGMGSA--QACPCQVPRAASATWVPCQ--I------------------
A0A2K5P2T8_BBC3-03      IKFGVGSA--RACPCQVPRAASATWVLCQ--I------------------
A0A2K5V8J3_BBC3-03      IKFGVGSA--RACPCQVPRASSATWVPCQ--I------------------
F7FFP6_BBC3-03          IKFGVGSA--RACPCQVPRASSATWVPCQ--I------------------
A0A2K6ASP2_BBC3-03      IKFGVGSA--RACPCQVPRASSATWVPCQ--I------------------
A0A2I3N2Z9_BBC3-03      IKFGVGSA--RACPCQVPRASSATWVPCQ--I------------------
A0A2K6QZU4_BBC3-04      IKFGVGSA--RACPCQVPRASSATWVPCQ--I------------------
A0A2R8MW85_BBC3-03      MKCGVGSA--WACPCQVPRASSSVWVPCQ--M------------------
A0A2K6STD6_BBC3-02      MKCGMGSA--WACPCQVPRASSLTWVPCQ--M------------------
G3T2N1_BBC3-01          CEPGLPRV---AGPRLLPGPRTQLFPSPS--PVWVSDLSGLQLERGGAEW
M3Y0R3_BBC3-01          WESDCSPR--VAAHGLFRAGAAAVSQPPP--PPVWVSLTSQRTIVGGSVG
Q99ML1_BBC3-02          CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGHRS
Q80ZG6_BBC3-01          CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGHRS
H0XQ00_BBC3-01          CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTATLGGPRWPGGPRS
J9NTK9_BBC3-01          CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
A0A337SQV0_BBC3-02      CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
F1RM01_BBC3-01          CEPGLPAA--PAAPTLLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
A0A2K6FQZ3_BBC3-01      CEPGLPAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
Q9BXH1_BBC3-06          CEPGLAAA--PAAPTLLP--AAYLCAPTA--PPAVTAALGGSRWPGGPRS
A0A2I3RIG5_BBC3-02      CEPGLAAA--PAAPTLLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
H2NZD3_BBC3-01          CEPGLAAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
A0A2K6QZU4_BBC3-01      CEPGLAAT--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
A0A0D9S2H2_BBC3-01      CEPGLAAA--PAAPALLP--AAYLCAPTA--PPAVTAALGGPRWPGGPRS
B4DQK3_BBC3-01          CEPGLAAA--PAAPTLLP--AAYLCAPTA--PPAVTAALGGSRWPGGPRS
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
K7E5Y2_BBC3-01          PAAGNQGQ------------------------------------------
A0A337SQV0_BBC3-01      ARRGPGPRRPAPLSPQPPGALGRVLRPLRARPARRPRRPRPAARRLPLRP
Q9BXH1_BBC3-03          ARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRP
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A337SQV0_BBC3-03      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
K7E5Y2_BBC3-02          PAAGNQGQ------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
F7FFP6_BBC3-03          --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2R8MW85_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
G3T2N1_BBC3-01          EDRAPRPL------------------------------------------
M3Y0R3_BBC3-01          RARGLLF-------------------------------------------
Q99ML1_BBC3-02          RPRGPRP-------------------------------------------
Q80ZG6_BBC3-01          RPRGPRP-------------------------------------------
H0XQ00_BBC3-01          RPRGPRL-------------------------------------------
J9NTK9_BBC3-01          RPRGPRP-------------------------------------------
A0A337SQV0_BBC3-02      RPRGPRP-------------------------------------------
F1RM01_BBC3-01          RPRGPRP-------------------------------------------
A0A2K6FQZ3_BBC3-01      RPRGPRP-------------------------------------------
Q9BXH1_BBC3-06          RPRGPRP-------------------------------------------
A0A2I3RIG5_BBC3-02      RPRGPRP-------------------------------------------
H2NZD3_BBC3-01          RPRGPRP-------------------------------------------
A0A2K6QZU4_BBC3-01      RPRGPRP-------------------------------------------
A0A0D9S2H2_BBC3-01      RPRGPRP-------------------------------------------
B4DQK3_BBC3-01          RPRGPRP-------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      ----------------------------------------SPG-------
K7E5Y2_BBC3-01          -----------------SGSLPSLGPRSAQEEGGQEGEPQGAS--PMSGG
A0A337SQV0_BBC3-01      HRPARRHRRPGGPPLAWGSPQPAPRAAPRRSSALTLAGRAAPG---IAGA
Q9BXH1_BBC3-03          HRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPG---VARA
A0A2K5F6X4_BBC3-02      -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A337SQV0_BBC3-03      -----------------C-PQPSL---SPAEQHLESPVPSAPG--ALAGG
Q9BXH1_BBC3-04          -----------------CETRGAA---AAPPLTLEGPVQSHHGTPALTQG
K7E5Y2_BBC3-02          -----------------SGSLPSLGPRSAQEEGGQEGEPQGAS--PMSGG
A0A2I3HWI8_BBC3-03      -----------------C-----------------------------AGG
A0A2K6FQZ3_BBC3-04      -----------------PGPQPSL---SLAEQHLESPVPSAPG--ALAGG
Q9BXH1_BBC3-05          -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2R9BZA9_BBC3-01      -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2I3RGH5_BBC3-03      -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2K5P2T8_BBC3-03      -----------------CGPQPSL---LLAEQHLESPVPSAPG--ALAGG
A0A2K5V8J3_BBC3-03      -----------------CGPQPSL---LLAEQHLESPVPSAPG--ALAGG
F7FFP6_BBC3-03          -----------------CGPQPSL---LLAEQHLESPVPSAPG--ALAGG
A0A2K6ASP2_BBC3-03      -----------------CGPQPSL---LLAEQHLESPVPSAPG--ALAGG
A0A2I3N2Z9_BBC3-03      -----------------CGPQPSL---LLAEQHLESPVPSAPG--ALAGG
A0A2K6QZU4_BBC3-04      -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2R8MW85_BBC3-03      -----------------CGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2K6STD6_BBC3-02      -----------------CGSQPSL---SLAEQHLESPVPSAPG--ALAGG
G3T2N1_BBC3-01          -----------------SGPQPSL---SPAEQHLESPV------------
M3Y0R3_BBC3-01          -----------------PGPQPSL---SPAEPHLESPVPSAPG--ALAGG
Q99ML1_BBC3-02          -----------------DGPQPSL---SPAQQHLESPVPSAPE--ALAGG
Q80ZG6_BBC3-01          -----------------DGPQPSL---SPAQQHLESPVPSAPE--ALAGG
H0XQ00_BBC3-01          -----------------DGPQPSL---LPAEQHLESPVPSTPG--ALAGG
J9NTK9_BBC3-01          -----------------DGPQPSL---SPAEQHLESPVPSAPG--ALAGG
A0A337SQV0_BBC3-02      -----------------DGPQPSL---SPAEQHLESPVPSAPG--ALAGG
F1RM01_BBC3-01          -----------------DGPQPSL---SPAEQHLESPVPSAPG--ALAGG
A0A2K6FQZ3_BBC3-01      -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
Q9BXH1_BBC3-06          -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2I3RIG5_BBC3-02      -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
H2NZD3_BBC3-01          -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A2K6QZU4_BBC3-01      -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
A0A0D9S2H2_BBC3-01      -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
B4DQK3_BBC3-01          -----------------DGPQPSL---SLAEQHLESPVPSAPG--ALAGG
                                                                          

A0A2K6KS56_BBC3-02      -ALAAPGVAGR------RRSGPGIGAQLRRMARRLNAQYRRR-RQEEQQR
K7E5Y2_BBC3-01          P----PGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQR-RREEEQR
A0A337SQV0_BBC3-01      QRPGGPGGRPHPGSPGSPGGGGAVGPGDRGPAAADGGRPQRAVRAAETRG
Q9BXH1_BBC3-03          QRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRG
A0A2K5F6X4_BBC3-02      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQPQ
A0A337SQV0_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQR
Q9BXH1_BBC3-04          PQSPRDGA--------------QLGACTRPVD-----------VRDSGGR
K7E5Y2_BBC3-02          P----PGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQR-RREEEQR
A0A2I3HWI8_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K6FQZ3_BBC3-04      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
Q9BXH1_BBC3-05          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2R9BZA9_BBC3-01      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2I3RGH5_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K5P2T8_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K5V8J3_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
F7FFP6_BBC3-03          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K6ASP2_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2I3N2Z9_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K6QZU4_BBC3-04      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2R8MW85_BBC3-03      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQPQ
A0A2K6STD6_BBC3-02      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQPQ
G3T2N1_BBC3-01          PTQAAPGVRGED-----EQWAREIGAQFRRKADDLYALYERSVRQEEQHR
M3Y0R3_BBC3-01          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQR
Q99ML1_BBC3-02          PTQAAPGVRVEE-----EEWAREIGAQLRRMADDLNAQYERR-RQEEQHR
Q80ZG6_BBC3-01          PTQAAPGVRVEE-----EEWAREIGAQLRRMADDLNAQYERR-RQEEQHR
H0XQ00_BBC3-01          PTQAAPEVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
J9NTK9_BBC3-01          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQR
A0A337SQV0_BBC3-02      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQR
F1RM01_BBC3-01          PTQAAPGIRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQR
A0A2K6FQZ3_BBC3-01      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
Q9BXH1_BBC3-06          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2I3RIG5_BBC3-02      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
H2NZD3_BBC3-01          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A2K6QZU4_BBC3-01      PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
A0A0D9S2H2_BBC3-01      PTQAAPGVRGEE-----EQWAQEIGAQLRRMADDLNAQYERR-RQEEQQR
B4DQK3_BBC3-01          PTQAAPGVRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQR
                                               :*.  *                 .   

A0A2K6KS56_BBC3-02      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
K7E5Y2_BBC3-01          RHLSPWRLLY--NLISGLLAPQRRNRMPDVEPN-----------------
A0A337SQV0_BBC3-01      AAATPPLTLE--------GPVQSHHGTPALTQGPRGPGDGAQLGACTRPV
Q9BXH1_BBC3-03          AAAAPPLTLE--------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPV
A0A2K5F6X4_BBC3-02      HRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN-----------------
A0A337SQV0_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRARGAPEMEPN-----------------
Q9BXH1_BBC3-04          PLPPPDTLASAGDFLCTM--------------------------------
K7E5Y2_BBC3-02          RHLSPWRLLY--NLISGLLAPQRRNRMPDVEPN-----------------
A0A2I3HWI8_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K6FQZ3_BBC3-04      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
Q9BXH1_BBC3-05          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2R9BZA9_BBC3-01      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2I3RGH5_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K5P2T8_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K5V8J3_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
F7FFP6_BBC3-03          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K6ASP2_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2I3N2Z9_BBC3-03      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K6QZU4_BBC3-04      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2R8MW85_BBC3-03      HRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN-----------------
A0A2K6STD6_BBC3-02      HRPSPWRVLY--NLIMGLLPFPRGHRAPEMEPN-----------------
G3T2N1_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRDHGAPEMEPN-----------------
M3Y0R3_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN-----------------
Q99ML1_BBC3-02          HRPSPWRVMY--NLFMGLLPLPRDPGAPEMEPN-----------------
Q80ZG6_BBC3-01          HRPSPWRVMY--NLFMGLLPLPRDPGAPEMEPN-----------------
H0XQ00_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
J9NTK9_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN-----------------
A0A337SQV0_BBC3-02      HRPSPWRVLY--NLIMGLLPLPRARGAPEMEPN-----------------
F1RM01_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGRGAPEMEPN-----------------
A0A2K6FQZ3_BBC3-01      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
Q9BXH1_BBC3-06          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2I3RIG5_BBC3-02      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
H2NZD3_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K6QZU4_BBC3-01      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
A0A0D9S2H2_BBC3-01      HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
B4DQK3_BBC3-01          HRPSPWRVLY--NLIMGLLPLPRGHRAPEMEPN-----------------
                           .*                                             

A0A2K6KS56_BBC3-02      --------------------------
K7E5Y2_BBC3-01          --------------------------
A0A337SQV0_BBC3-01      DVGDLGGRTLPPPDALASAGDFFCTM
Q9BXH1_BBC3-03          DVRDSGGRPLPPPDTLASAGDFLCTM
A0A2K5F6X4_BBC3-02      --------------------------
A0A337SQV0_BBC3-03      --------------------------
Q9BXH1_BBC3-04          --------------------------
K7E5Y2_BBC3-02          --------------------------
A0A2I3HWI8_BBC3-03      --------------------------
A0A2K6FQZ3_BBC3-04      --------------------------
Q9BXH1_BBC3-05          --------------------------
A0A2R9BZA9_BBC3-01      --------------------------
A0A2I3RGH5_BBC3-03      --------------------------
A0A2K5P2T8_BBC3-03      --------------------------
A0A2K5V8J3_BBC3-03      --------------------------
F7FFP6_BBC3-03          --------------------------
A0A2K6ASP2_BBC3-03      --------------------------
A0A2I3N2Z9_BBC3-03      --------------------------
A0A2K6QZU4_BBC3-04      --------------------------
A0A2R8MW85_BBC3-03      --------------------------
A0A2K6STD6_BBC3-02      --------------------------
G3T2N1_BBC3-01          --------------------------
M3Y0R3_BBC3-01          --------------------------
Q99ML1_BBC3-02          --------------------------
Q80ZG6_BBC3-01          --------------------------
H0XQ00_BBC3-01          --------------------------
J9NTK9_BBC3-01          --------------------------
A0A337SQV0_BBC3-02      --------------------------
F1RM01_BBC3-01          --------------------------
A0A2K6FQZ3_BBC3-01      --------------------------
Q9BXH1_BBC3-06          --------------------------
A0A2I3RIG5_BBC3-02      --------------------------
H2NZD3_BBC3-01          --------------------------
A0A2K6QZU4_BBC3-01      --------------------------
A0A0D9S2H2_BBC3-01      --------------------------
B4DQK3_BBC3-01          --------------------------
                                                  

© 1998-2019