Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

101 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
F6Z067_BAD-01          --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
G1SS60_BAD-01          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A337SAW2_BAD-01      MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3VRY4_BAD-01          --------------------------------------------------
G3VRY4_BAD-02          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
I3MBM5_BAD-01          --------------------------------------------------
I3MBM5_BAD-02          --------------------------------------------------
A0A091DDU4_BAD-01      --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
A0A1U7Q4V0_BAD-01      --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          -----------------------------------------------MGD
F6Z067_BAD-01          -----------------------------------------------MAD
I3K7B6_BAD-01          --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
G1SS60_BAD-01          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------QGPRYR
G3VRY4_BAD-01          --------------------------------------------------
G3VRY4_BAD-02          --------------------------------------------------
G3TP47_BAD-01          ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
I3MBM5_BAD-01          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-02          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
A0A091DDU4_BAD-01      --------------------------------------------------
Q61337_BAD-02          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
Q61337_BAD-03          --------------------------------------------------
A0A1U7Q4V0_BAD-01      -------------MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRR
Q61337_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
G1MI17_BAD-01          -------------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALA
A0A287AEF3_BAD-01      -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
O35147_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
M3YNE7_BAD-01          --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A1S3FL84_BAD-01      --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          ---------------TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLA
Q45KI9_BAD-01          --------------------------------------------------
                                                                         

F7GVS7_BAD-04          ---------------------------------------MEE--EP----
Q2PG01_BAD-01          ---------------------------------------MEE--EP----
A0A2I3H4B2_BAD-01      ---------------------------------------MGE--EP----
Q6P7C5_BAD-01          PAAQSMFQIPEFEPSEQEDA--------STTDRGLGPSLTEDQPGPYLAP
A0A287AEF3_BAD-02      -----MFQIPEFEQSEQEDS--------SPADRGLGPSPTGTDPQAPASP
C1C3S9_BAD-01          SPHKSMFSIEEFPPTER-----------GSAFSGTNPPGFGG--DPGHKS
F6Z067_BAD-01          SSPSAVFKLEEFDNEEQ-----------GLPLPFVDPPRGAGVRQPVAKS
I3K7B6_BAD-01          -----MAANFTISDSESETS--------EEVGEEENQQPAGQ--DQESKP
B5X1T1_BAD-01          -----MDHTHDCVDDN---P--------ETMNEHDESDHSGT--THYPEF
Q4V925_BAD-02          -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKH--KSGSAQ
Q4V925_BAD-03          -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKH--KSGSAQ
A7MCM4_BAD-01          -----MAHMFNISDDSE--T--------ETMEDSEASSLDKH--KSGSAQ
Q4V925_BAD-04          -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKH--KSGSAQ
Q4V925_BAD-01          -----MAHMFNISDDSE--T--------ETMEDSEDSSLDKH--KSGSAQ
G3Q8B3_BAD-01          -----MAAHFTISDSESEPS--------DGVEEREDGQLSSG--QEQQRL
A0A087X8P8_BAD-01      -----MDAKFTISDSDSEPS--------EDVEERGNLQLMQV--KERPLS
E7FBJ6_BAD-01          --------MENTSHDHQDDS--------------STLDEKER--SHLKGT
B5XEF1_BAD-01          ---------MDYTHDCVDEC--------ESDHSGTTRNSEFQ--LHVSTT
G1SS60_BAD-01          --------------------------------------------------
H3D8J8_BAD-01          -MAAKFSLCSDSDSEPSEEV--------EEGERGSF-----------STS
H3ANP3_BAD-03          -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEK--T--AGL
H3ANP3_BAD-04          -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEK--T--AGL
H3ANP3_BAD-01          -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEK--T--AGL
H3ANP3_BAD-02          -----MFQISDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEK--T--AGL
A0A337SAW2_BAD-01      AWAQSMFQIPEFEPSEQEDS--------SPTDRGLGPSPTGD--RP-RGP
A0A2U9BAC9_BAD-01      --MAANFTISDSESEPSEEV--------EEGEVSQPWTGPGE--QV---P
A0A2I3TBK7_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2R8Z697_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2I2Z8C7_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
Q92934_BAD-03          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2K5M0C1_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2K5XJR2_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2I3MCN5_BAD-03      -----MFQIPEFEPSEQEDS--------RSAERGLGPSPAGD--KP-SDS
A0A2K5VCD8_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
F7GVS7_BAD-02          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K6E7J3_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K5E6K7_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--RP-PGS
A0A2K6TG62_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--SP-PGS
A0A2K5E6K7_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--RP-PGS
A0A2K5HKW9_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K6N1A1_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K6PUM5_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K5M0C1_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2K5VCD8_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
F7GVS7_BAD-03          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K5XJR2_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2I3MCN5_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--KP-SDS
A0A2K6E7J3_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2I2Z8C7_BAD-04      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
Q92934_BAD-04          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2I3TBK7_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2R8Z697_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
F6SJL0_BAD-02          -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--RP-PGS
A0A2K6TG62_BAD-03      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--SP-PGS
G1P8C5_BAD-01          PTAQSMFQIPEFEHSEQEDS--------SPADRGLGPCPTGD--QP-PGL
W5P8G9_BAD-01          AWAQSMFQIPEFEQSEQEDS--------SPADRGLGPSPTGD--RP-PGL
G3VRY4_BAD-01          -----MFQISEFEPSEPGED--------PSASTAPSLAPLRP--GPRAAP
G3VRY4_BAD-02          -----MFQISEFEPSEPGED--------PSASTAPSLAPLRP--GPRAAP
G3TP47_BAD-01          GGLQSMFQIPEFEQSDREDS--------TPADRGLGPSPEGY--WP-SGP
I3MBM5_BAD-01          AWTQSMFQIPEFEPSEQEDS--------SSAEGGLGPSPAGD--RP-GCG
I3MBM5_BAD-02          AWTQSMFQIPEFEPSEQEDS--------SSAEGGLGPSPAGD--RP-GCG
A0A091DDU4_BAD-01      -----MFQIPEFEPSEQEDS--------SSEERGLGPSPIGD--QL-GPS
Q61337_BAD-02          PAAQSMFQIPEFEPSEQEDA--------SATDRGLGPSLTED--QP-GPY
Q61337_BAD-03          -----MFQIPEFEPSEQEDA--------SATDRGLGPSLTED--QP-GPY
A0A1U7Q4V0_BAD-01      PAAQSMFQIPEFEPSEQEDS--------NTADRGLGPSLTGD--PP-GPC
Q61337_BAD-01          PAAQSMFQIPEFEPSEQEDA--------SATDRGLGPSLTED--QP-GPY
G1MI17_BAD-01          PTAQSMFQIPEFEPSEQEDS--------SPADRGLGPSPTGD--QP-PGP
A0A287AEF3_BAD-01      PASQSMFQIPEFEQSEQEDS--------SPADRGLGPSPTGT--DP----
O35147_BAD-01          PAAQSMFQIPEFEPSEQEDA--------STTDRGLGPSLTED--QP-GPY
M3YNE7_BAD-01          -----MFQIPEFEPSEQEDS--------SPADRGLGPSPTGD--QP-PGL
F1MUT9_BAD-01          -----MFQIPEFEQSEQEDS--------SPADRGLGPSPTGD--RP-PGL
Q3SYZ0_BAD-01          -----MFQIPEFEQSEQEDS--------SRADRGLGPSPTGD--RP-PGL
F7DN67_BAD-01          -----MFQIPEFEQSEPEDS--------SPADRGLGPSPTGD--WP-SDP
H0WVR2_BAD-01          -----MFQIPEFEPSEQEDS--------SSSDRGLGPSPSGD--QP-LGP
H0V608_BAD-01          -----MFQIPEFEPSEQEDS--------SSEERGLGPSPTGD--EL-GSS
A0A1S3FL84_BAD-01      -----MFQIPEFEPSEQEDS--------SSADRGLGPSLC----------
A0A2K5E6K7_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--RP-PGS
A0A2K6TG62_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--SP-PGS
A0A0D9R491_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGN--RP-SDS
A0A2K5M0C1_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2K5VCD8_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
F7GVS7_BAD-01          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K6E7J3_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K5XJR2_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSLAGD--RP-SDC
A0A2I3MCN5_BAD-04      -----MFQIPEFEPSEQEDS--------RSAERGLGPSPAGD--KP-SDS
A0A2K6N1A1_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K6PUM5_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
A0A2K5HKW9_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SDS
B4DZQ9_BAD-01          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2K6GWV0_BAD-01      -----MFQIPEFEPSEQEDS--------SSAGRGLGPSPSGD--RP-SGP
F6SJL0_BAD-01          -----MFQIPEFEPSEQEDS--------SSAERGLSPSTAGD--RP-PGS
A0A2I3MCN5_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--KP-SDS
A0A2I2Z8C7_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2I2Z8C7_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
Q92934_BAD-01          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
Q92934_BAD-02          -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2I3TBK7_BAD-02      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2R8Z697_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--GP-SGS
A0A2J8TYJ3_BAD-01      -----MFQIPEFEPSEQEDS--------SSAERGLGPSPAGD--RP-SGS
F1PK10_BAD-01          PTAQSMFQIPEFEPSEQEDS--------SPANRGLGPSPTGD--RP-PSP
Q45KI9_BAD-01          -----MFQIPEFEPSEQEDS--------SPANRGLGPSPTGD--RP-PSP
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          G-----LLGSIVQQ------------------------------------
A0A287AEF3_BAD-02      GARPQATWGKLVTSRGSRPA-AATMEALG---------------------
C1C3S9_BAD-01          SPNLRRIKGKETRQRTESASEASETDSVG---------------------
F6Z067_BAD-01          SPSLRRYPGKESRLRTESASESSETDKVG---------------------
I3K7B6_BAD-01          QTLALPVIKT-------TVQ----PNQWNALGMRDEDLMARGED--EVCT
B5X1T1_BAD-01          QRHYVSTRTGIRPRPGGRVR-LYSESQVCSQVGRRDNTEFQDVMTPTEEG
Q4V925_BAD-02          KKQHLTVPD--------RLK----GEQ----LGRQRNLSMNEEDLLETGV
Q4V925_BAD-03          KKQHLTVPD--------RLK----GEQ----LGRQRNLSMNEEDLLETGV
A7MCM4_BAD-01          KKQHLTVPD--------RLK----GEQ----LGRQRNLSMNEEDLLETGV
Q4V925_BAD-04          KKQHLTVPD--------RLK----GEQ----LGRQRNLSMNEEDLLETGV
Q4V925_BAD-01          KKQHLTVPD--------RLK----GEQ----LGRQRNLSMNEEDLLETGV
G3Q8B3_BAD-01          QRHTLTLPEL-------RLS----GRKSQRIVEKEEELWL---D--ETGT
A0A087X8P8_BAD-01      QRHTLTLPELRSTTGRVRLN----SESIASTISREEELQARGEE--EVGT
E7FBJ6_BAD-01          IKNHGQHQDRTSANISPQGR-VRLYSESQ-VYT-VSRWQDTETQD--GAS
B5XEF1_BAD-01          MSNRPR----------PGER-VRLYSESQ-VRSQVGKREDTEFQDVMTPT
G1SS60_BAD-01          ---------------------PRPKPLSA-GAGAMETR--SRHSSYPADA
H3D8J8_BAD-01          GRIRVNSESQASAVSRDEEL---------------------------QGN
H3ANP3_BAD-03          KKHSRTAPNLQNPGPHQSHP-PSHTGVYG-WVKLRKRNNMEILGRPSSES
H3ANP3_BAD-04          KKHSRTAPNLQNPGPHQSHP-PSHTVFWG-FT-----DNMEILGRPSSES
H3ANP3_BAD-01          KKHSRTAPNLQNPGPHQSHP-PSH-------T-----DNMEILGRPSSES
H3ANP3_BAD-02          KKHSRTAPNLQNPGPHQSHP-PSH-------T-----DNMEILGRPSSES
A0A337SAW2_BAD-01      GKHQRTTPGLLGEAGHQQGQ-PASSNHHG-GAGAVETR--SRHSSYPAGT
A0A2U9BAC9_BAD-01      PRHTLALPELRMAATGRIRLNSESNASTL-----------SRDEELLTRW
A0A2I3TBK7_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNPDAAK
A0A2R8Z697_BAD-02      SKHHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNADAAK
A0A2I2Z8C7_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERRHSNADAAK
Q92934_BAD-03          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNADAAK
A0A2K5M0C1_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
A0A2K5XJR2_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
A0A2I3MCN5_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
A0A2K5VCD8_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
F7GVS7_BAD-02          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
A0A2K6E7J3_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDADAAK
A0A2K5E6K7_BAD-02      GKHPRQAPGLPGDASHQQGQ-PTSSSHHG-GT---SSPEERGHSNADAAK
A0A2K6TG62_BAD-02      GKHRRQAPGLPGDASHQQGQ-PTSSSHHG-GT---SSPEERGHSNADAAK
A0A2K5E6K7_BAD-03      GKHPRQAPGLPGDASHQQGQ-PTSSSHHG-GE--YSTCASASSSENPSAR
A0A2K5HKW9_BAD-02      GKHHRQAPGLLWDASHQQEQ-ATSSSHHG-GRAWYSPS-ESEDSENPSAR
A0A2K6N1A1_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYYPA-ESEDSENPSAR
A0A2K6PUM5_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYYPA-ESEDSENPSAR
A0A2K5M0C1_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GGAWYSPSWESEDSENPSAR
A0A2K5VCD8_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENPSAR
F7GVS7_BAD-03          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENPSAR
A0A2K5XJR2_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GGAWYSPSWESEDSENPSAR
A0A2I3MCN5_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENPSAR
A0A2K6E7J3_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENPSAR
A0A2I2Z8C7_BAD-04      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENPSAG
Q92934_BAD-04          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENPSAG
A0A2I3TBK7_BAD-03      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENPSAG
A0A2R8Z697_BAD-03      SKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENPSAG
F6SJL0_BAD-02          GKHRRQAPGLPGDASHQQGQ-STSSSHHG---------------ENPSVR
A0A2K6TG62_BAD-03      GKHRRQAPGLPGDASHQQGQ-PTSSSHHG---------------ENPSAK
G1P8C5_BAD-01          NKHWSTVPGLLGEAGHQQGQ-PASSSHHD-GAGSVEPR--SRHSSYPTGT
W5P8G9_BAD-01          SKHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYPAGP
G3VRY4_BAD-01          GAHHHEGAGAGRPRLISYPPL----------------REGSREASPEAEA
G3VRY4_BAD-02          GAHHHEKGGAQKSQTHVSKELKASASQGRLGKGSFEGREGSREASPEAEA
G3TP47_BAD-01          SDRHRVAPGFLRDSSHQQGQ-PTSSGHHG-GAAAVETR--SRHSSYPAGS
I3MBM5_BAD-01          -----LAPGLPRDTGHQQWQ-ATSSSNHG-GAGATETR--SRHSSYPADT
I3MBM5_BAD-02          -----LAPGLPRDTGHQQWQ-ATSSSNHG-GAGATETR--SRHSSYPADT
A0A091DDU4_BAD-01      -----PARGFLGDTSHQQRQ-LFSSRHHG-GAGAMETR--SRHSSYPTGT
Q61337_BAD-02          -----LAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYPAGT
Q61337_BAD-03          -----LAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYPAGT
A0A1U7Q4V0_BAD-01      -----LAPGLLGNIRHQQEQ-AANSSHHG-GTGAMETR--SRHSSYTAGN
Q61337_BAD-01          -----LAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYPAGT
G1MI17_BAD-01          GKHRQTAPGLLGEAAHPQGQ-PASSNHHG-GAGAVEPR--SRHSSYPAGT
A0A287AEF3_BAD-01      -QPWRTAPGHLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYPEGT
O35147_BAD-01          -----LAPGLLGSIVQQQPGQAANNSHHG-GAGTMETR--SRHSSYPAGT
M3YNE7_BAD-01          GKHLQTAPGLLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYPAGT
F1MUT9_BAD-01          SKHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYRAGP
Q3SYZ0_BAD-01          SKHWLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYRAGP
F7DN67_BAD-01          VRHQRTAPGLLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYPEGT
H0WVR2_BAD-01          GKNRCTTPSLLGDASHLQGQ-PASNTHHGAGPGAVETR--SRHSSYPAGT
H0V608_BAD-01          -----PAGGFLGDTSHQQRQLRSSRSHHG-GTVAMETR--SRHRSYPAGT
A0A1S3FL84_BAD-01      -----PAPGLLGDHSPQQGL-PTSRSHHG-GAGAVETR--SRHSSYPAGM
A0A2K5E6K7_BAD-01      GKHPRQAPGLPGDASHQQGQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K6TG62_BAD-01      GKHRRQAPGLPGDASHQQGQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A0D9R491_BAD-01      GKHHHQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K5M0C1_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K5VCD8_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
F7GVS7_BAD-01          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K6E7J3_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K5XJR2_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2I3MCN5_BAD-04      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K6N1A1_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K6PUM5_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2K5HKW9_BAD-01      GKHHRQAPGLLWDASHQQEQ-ATSSSHHG-GAGAVETR--SRHSSHPAGT
B4DZQ9_BAD-01          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
A0A2K6GWV0_BAD-01      GKHPCTAPSFLGDASHQQGQ-PSSSSHHG-GAGSVETR--SRHSSYPAGT
F6SJL0_BAD-01          GKHRRQAPGLPGDASHQQGQ-STSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2I3MCN5_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYPAGT
A0A2I2Z8C7_BAD-01      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
A0A2I2Z8C7_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
Q92934_BAD-01          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
Q92934_BAD-02          GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
A0A2I3TBK7_BAD-02      GKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
A0A2R8Z697_BAD-01      SKHHRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
A0A2J8TYJ3_BAD-01      SKHHRQAPGLLRDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYPAGT
F1PK10_BAD-01          GKHQQTAPGLLGEAGHQQGQ-PASRKHHG-GAGA-ETR--SRHSSFPAGT
Q45KI9_BAD-01          GKHQQTAPGLLGEAGHQQGQ-PASRKHHG-GAGA-ETR--SRHSSFPAGT
                                                                         

F7GVS7_BAD-04          -----------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-KVS
Q2PG01_BAD-01          -----------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2I3H4B2_BAD-01      -----------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          ---------ELQHFRSRSRSAPSSLMVAARYGRELRRMSDEFDQIF-T--
F6Z067_BAD-01          ---------ELHPFRSRSRSAPSS-MIATKYGRELRRMSDEFEKSF-T--
I3K7B6_BAD-01          PTE----G---DPFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDK--
B5X1T1_BAD-01          GGD----G---APFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDK--
Q4V925_BAD-02          AEDPHMLG---DPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----DK--
Q4V925_BAD-03          AEDPHMLG---DPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----DK--
A7MCM4_BAD-01          AEDPHMLG---DPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----DK--
Q4V925_BAD-04          AEDPHMLG---DPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----DK--
Q4V925_BAD-01          AEDPHMLG---DPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----DK--
G3Q8B3_BAD-01          PTE----G---APFRVRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDK--
A0A087X8P8_BAD-01      PTE----G---FPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDK--
E7FBJ6_BAD-01          VEENGDG----LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDK--
B5XEF1_BAD-01          EEGGGDG----ASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDK--
G1SS60_BAD-01          DDSEGAEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSVKK--
H3D8J8_BAD-01          GDDEAGTPTDGAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLDK--
H3ANP3_BAD-03          QISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSF-L--
H3ANP3_BAD-04          QISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSF-L--
H3ANP3_BAD-01          QISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSF-L--
H3ANP3_BAD-02          QISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFDMSF-L--
A0A337SAW2_BAD-01      EEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSF-K--
A0A2U9BAC9_BAD-01      DEEAGTPTDG-APFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLDK--
A0A2I3TBK7_BAD-01      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-E--
A0A2R8Z697_BAD-02      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-E--
A0A2I2Z8C7_BAD-03      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAAHP-E--
Q92934_BAD-03          LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-E--
A0A2K5M0C1_BAD-02      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-E--
A0A2K5XJR2_BAD-02      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-E--
A0A2I3MCN5_BAD-03      LQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-E--
A0A2K5VCD8_BAD-02      LQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-E--
F7GVS7_BAD-02          LQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-E--
A0A2K6E7J3_BAD-02      LQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-E--
A0A2K5E6K7_BAD-02      LQLDASHPVLVGSELGQG---------------RLRSLPVTFAPHP-E--
A0A2K6TG62_BAD-02      LQLDASHPVLVGSELGQG---------------RLRSLPVTFAPHP-E--
A0A2K5E6K7_BAD-03      MLSKASAGMSAPATDS-----E---------NVKLE-VPC-W---V-A--
A0A2K5HKW9_BAD-02      MLTEASAGMSAPATDSEAQHAE---------NVKLEALGL-WRPGV-A--
A0A2K6N1A1_BAD-02      MLAEASAGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV-A--
A0A2K6PUM5_BAD-02      MLAEASAGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV-A--
A0A2K5M0C1_BAD-03      MLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-A--
A0A2K5VCD8_BAD-03      MLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-A--
F7GVS7_BAD-03          MLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-A--
A0A2K5XJR2_BAD-03      MLAEASARMSAPATDSEAQLAE---------NVKLKALGL-WRPGV-A--
A0A2I3MCN5_BAD-02      MLAEASAPMSAPATDSEAQHAE---------NVKLKALGL-WRRGV-A--
A0A2K6E7J3_BAD-03      MLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPAV-A--
A0A2I2Z8C7_BAD-04      MLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-A--
Q92934_BAD-04          MLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-A--
A0A2I3TBK7_BAD-03      MLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-A--
A0A2R8Z697_BAD-03      MLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-A--
F6SJL0_BAD-02          MFSKASAGMSAPATDSEAQHTE---------NVKLEALGL-WRPGV-A--
A0A2K6TG62_BAD-03      MLSKASAGMSAPATDSEAQHTE---------NVKLEALEP-WRHGV-A--
G1P8C5_BAD-01          EEDDDTEEGEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFKK--
W5P8G9_BAD-01          EDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-K--
G3VRY4_BAD-01          EAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-K--
G3VRY4_BAD-02          EAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-K--
G3TP47_BAD-01          DEAEGLEEDP-SPFRGRSLSAPPNLWAAQRYGRELRRMSDEFQGYF-K--
I3MBM5_BAD-01          DLDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
I3MBM5_BAD-02          DLDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
A0A091DDU4_BAD-01      EEEEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
Q61337_BAD-02          EEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
Q61337_BAD-03          EEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
A0A1U7Q4V0_BAD-01      EEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
Q61337_BAD-01          EEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
G1MI17_BAD-01          EEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSF-K--
A0A287AEF3_BAD-01      EEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEFQGSF-K--
O35147_BAD-01          EEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-K--
M3YNE7_BAD-01          EEDEGMEEEELSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSF-K--
F1MUT9_BAD-01          EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-K--
Q3SYZ0_BAD-01          EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-K--
F7DN67_BAD-01          EDEGMEGEEP-GPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSFQK--
H0WVR2_BAD-01          EEDEGI-EEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKK--
H0V608_BAD-01          EEEEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A1S3FL84_BAD-01      EEDEGLEEEP-SPFRGRSRSAPPNLWAARRYGRELRRMSDEFDGSF-K--
A0A2K5E6K7_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K6TG62_BAD-01      EGDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A0D9R491_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K5M0C1_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K5VCD8_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
F7GVS7_BAD-01          EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K6E7J3_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K5XJR2_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2I3MCN5_BAD-04      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K6N1A1_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K6PUM5_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
A0A2K5HKW9_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-K--
B4DZQ9_BAD-01          EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2K6GWV0_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFKK--
F6SJL0_BAD-01          EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2I3MCN5_BAD-01      EEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2I2Z8C7_BAD-01      EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2I2Z8C7_BAD-02      EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
Q92934_BAD-01          EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
Q92934_BAD-02          EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2I3TBK7_BAD-02      EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2R8Z697_BAD-01      EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
A0A2J8TYJ3_BAD-01      EDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKK--
F1PK10_BAD-01          DEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF-K--
Q45KI9_BAD-01          DEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF-K--
                                                                         

F7GVS7_BAD-04          AGP-PPRPPRAGLSLPCPKARP-----------DLMSHDPSPTPSCPFLA
Q2PG01_BAD-01          --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2I3H4B2_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
Q6P7C5_BAD-01          ------QPGQAANNSHHGGRFLTSIIFLSHVP------------------
A0A287AEF3_BAD-02      ----LWRPGVATALTQRGPRRMKGLRMRSSAPSAADRSRRPPSSGLHSVM
C1C3S9_BAD-01          --S-IPRPKSASAATEMTVSKSFGETFFNFFRRKNKDRSQSENDKH----
F6Z067_BAD-01          --G-LPRPKSASAAGQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE----
I3K7B6_BAD-01          --GEMK-------LKKLHHSKTWWSYLFSHQETEGENNHLE---------
B5X1T1_BAD-01          --GEPKRGISPGGVKQ-EVSRGWFSFLWSPKKAEGRE-------------
Q4V925_BAD-02          --G-MKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE---------
Q4V925_BAD-03          --G-MKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE---------
A7MCM4_BAD-01          --GQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE---------
Q4V925_BAD-04          --GQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE---------
Q4V925_BAD-01          --GQMKRVKSAGTARQMSQSPSWLAFLWSHKESDAESRPAE---------
G3Q8B3_BAD-01          --GEMRRVKSAGTTKQMQHSKSWWSSLFSHQEMEGENNHHE---------
A0A087X8P8_BAD-01      --GEMRKVSSTGSNRPIHHSRSWWSYLFSHQETEGENNHHENHASRTE--
E7FBJ6_BAD-01          --G-VSK----TPNSQKQTYRGWFSFL---WSPKEEEGRE----------
B5XEF1_BAD-01          --G-VPKRGIIPRGGKQKVSRGWFSFL---WSPKEAEGRE----------
G1SS60_BAD-01          --G-LPRPKSAGTAMQMRESSSWTRVIQSWWDRNLGKGGSAPSQ------
H3D8J8_BAD-01          --GGMRKTSSAGSARQMHHSRSWWSYLFSHQETESENNHHD---------
H3ANP3_BAD-03          --G-LPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQ--------
H3ANP3_BAD-04          --G-LPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQ--------
H3ANP3_BAD-01          --G-LPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQQGVSIRGP
H3ANP3_BAD-02          --G-LPRPKSAGAAGEMVDESWWKKLIRSLKGRGQPRDPPGQQGVSIRGP
A0A337SAW2_BAD-01      --G-LPRPKSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ------
A0A2U9BAC9_BAD-01      --GEMRKVKSAGTARQMHHSQSWWSYLFSHQEMEGENNHHENHTQRNE--
A0A2I3TBK7_BAD-01      --T-PPVPTALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTP
A0A2R8Z697_BAD-02      --T-PPVPTALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTQ
A0A2I2Z8C7_BAD-03      --T-PPVPTALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGRLTQ
Q92934_BAD-03          --T-PPVPTALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTQ
A0A2K5M0C1_BAD-02      --T-PPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQ
A0A2K5XJR2_BAD-02      --T-PPALTVLVGHLGYGRKCFPQASCK--------RGSVLPLSVGGLTQ
A0A2I3MCN5_BAD-03      --T-PPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQ
A0A2K5VCD8_BAD-02      --T-PPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQ
F7GVS7_BAD-02          --T-PPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQ
A0A2K6E7J3_BAD-02      --T-PPALTVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQ
A0A2K5E6K7_BAD-02      --T-PPVPIALGGHLGYGRKCFLQ---------------------GELTQ
A0A2K6TG62_BAD-02      --T-LPAPIALGGHLGHGRKCFLQ---------------------GGLTQ
A0A2K5E6K7_BAD-03      --T-APTPQGRRRTKGWRRSPAPFGAVRAQHPPTSGQHSAMAASSGG---
A0A2K5HKW9_BAD-02      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG---
A0A2K6N1A1_BAD-02      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG---
A0A2K6PUM5_BAD-02      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG---
A0A2K5M0C1_BAD-03      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2K5VCD8_BAD-03      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
F7GVS7_BAD-03          --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2K5XJR2_BAD-03      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2I3MCN5_BAD-02      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2K6E7J3_BAD-03      --T-APTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG---
A0A2I2Z8C7_BAD-04      --T-APTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG---
Q92934_BAD-04          --T-APTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG---
A0A2I3TBK7_BAD-03      --T-APTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG---
A0A2R8Z697_BAD-03      --T-APTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG---
F6SJL0_BAD-02          --T-ARTPQGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG---
A0A2K6TG62_BAD-03      --T-ARTPQGRRGTKGWRRSPALFGAVRARHPPTSGQHSDMAASSGG---
G1P8C5_BAD-01          --G-LPRPKSAGTATQMWQKSSWTRFFQSWWDRNSGRGGSAPSQ------
W5P8G9_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ------
G3VRY4_BAD-01          --G-LPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH------
G3VRY4_BAD-02          --G-LPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH------
G3TP47_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ------
I3MBM5_BAD-01          --G-LPRPRSAGTASQMRQSSSWTRFIQSWWDRNLGRRGSAPSQ------
I3MBM5_BAD-02          -----------------------VTFSQSPFLRA----------------
A0A091DDU4_BAD-01      --G-LPRPKSAGTATKLWQSSSWTRAIQSWWDRNLGRGGSAPSQ------
Q61337_BAD-02          --G-----------EELTYSLSPFRCVQ----------------------
Q61337_BAD-03          --G-LPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ------
A0A1U7Q4V0_BAD-01      --G-LPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ------
Q61337_BAD-01          --G-LPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ------
G1MI17_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ------
A0A287AEF3_BAD-01      --G-LPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ------
O35147_BAD-01          --G-LPRPKSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ------
M3YNE7_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ------
F1MUT9_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ------
Q3SYZ0_BAD-01          --G-LPRPKSAGTATEMRQSPSWTRFLQSWLSRNLGRGGSAPSQ------
F7DN67_BAD-01          --A-LPRPKSAGTATQMRQSPSWTRAIQSWWDRNLGRGGSAPSQ------
H0WVR2_BAD-01          --G-LPRPKSAGTATQMRQSSSWTRVIQSWWDRNVGRGGSAPCQ------
H0V608_BAD-01          --G-LPRPKSAGTATKLWQNSNWTRAIQSWWDRNLGRGGSAPSQESV---
A0A1S3FL84_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRIFQSWWDRNLGRG-SAPSQ------
A0A2K5E6K7_BAD-01      --G-LPRPKSAGTATQMRQSSSWTQVIQSWWDRNLGRGGSAPSQ------
A0A2K6TG62_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ------
A0A0D9R491_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K5M0C1_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K5VCD8_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
F7GVS7_BAD-01          --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K6E7J3_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K5XJR2_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2I3MCN5_BAD-04      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K6N1A1_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K6PUM5_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2K5HKW9_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
B4DZQ9_BAD-01          --G-LPRPKSAGTATQMRQSPRRLR-------------------------
A0A2K6GWV0_BAD-01      --G-LPRPKSAGTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ------
F6SJL0_BAD-01          --G-LPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ------
A0A2I3MCN5_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2I2Z8C7_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2I2Z8C7_BAD-02      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
Q92934_BAD-01          --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
Q92934_BAD-02          --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2I3TBK7_BAD-02      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2R8Z697_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
A0A2J8TYJ3_BAD-01      --G-LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------
F1PK10_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ------
Q45KI9_BAD-01          --G-LPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ------
                                                                         

F7GVS7_BAD-04          P-----
Q2PG01_BAD-01          ------
A0A2I3H4B2_BAD-01      ------
Q6P7C5_BAD-01          ------
A0A287AEF3_BAD-02      AASSGG
C1C3S9_BAD-01          ------
F6Z067_BAD-01          ------
I3K7B6_BAD-01          ------
B5X1T1_BAD-01          ------
Q4V925_BAD-02          ------
Q4V925_BAD-03          ------
A7MCM4_BAD-01          ------
Q4V925_BAD-04          ------
Q4V925_BAD-01          ------
G3Q8B3_BAD-01          ------
A0A087X8P8_BAD-01      ------
E7FBJ6_BAD-01          ------
B5XEF1_BAD-01          ------
G1SS60_BAD-01          ------
H3D8J8_BAD-01          ------
H3ANP3_BAD-03          ------
H3ANP3_BAD-04          ------
H3ANP3_BAD-01          D-----
H3ANP3_BAD-02          D-----
A0A337SAW2_BAD-01      ------
A0A2U9BAC9_BAD-01      ------
A0A2I3TBK7_BAD-01      IPFRCV
A0A2R8Z697_BAD-02      IPFRCV
A0A2I2Z8C7_BAD-03      IPFRCV
Q92934_BAD-03          IPFRCV
A0A2K5M0C1_BAD-02      IPFRCM
A0A2K5XJR2_BAD-02      IPFRCM
A0A2I3MCN5_BAD-03      IPFRCM
A0A2K5VCD8_BAD-02      IPFRCM
F7GVS7_BAD-02          IPFRCM
A0A2K6E7J3_BAD-02      IPFRCM
A0A2K5E6K7_BAD-02      IPFRCV
A0A2K6TG62_BAD-02      IPFRCV
A0A2K5E6K7_BAD-03      ------
A0A2K5HKW9_BAD-02      ------
A0A2K6N1A1_BAD-02      ------
A0A2K6PUM5_BAD-02      ------
A0A2K5M0C1_BAD-03      ------
A0A2K5VCD8_BAD-03      ------
F7GVS7_BAD-03          ------
A0A2K5XJR2_BAD-03      ------
A0A2I3MCN5_BAD-02      ------
A0A2K6E7J3_BAD-03      ------
A0A2I2Z8C7_BAD-04      ------
Q92934_BAD-04          ------
A0A2I3TBK7_BAD-03      ------
A0A2R8Z697_BAD-03      ------
F6SJL0_BAD-02          ------
A0A2K6TG62_BAD-03      ------
G1P8C5_BAD-01          ------
W5P8G9_BAD-01          ------
G3VRY4_BAD-01          ------
G3VRY4_BAD-02          ------
G3TP47_BAD-01          ------
I3MBM5_BAD-01          ------
I3MBM5_BAD-02          ------
A0A091DDU4_BAD-01      ------
Q61337_BAD-02          ------
Q61337_BAD-03          ------
A0A1U7Q4V0_BAD-01      ------
Q61337_BAD-01          ------
G1MI17_BAD-01          ------
A0A287AEF3_BAD-01      ------
O35147_BAD-01          ------
M3YNE7_BAD-01          ------
F1MUT9_BAD-01          ------
Q3SYZ0_BAD-01          ------
F7DN67_BAD-01          ------
H0WVR2_BAD-01          ------
H0V608_BAD-01          ------
A0A1S3FL84_BAD-01      ------
A0A2K5E6K7_BAD-01      ------
A0A2K6TG62_BAD-01      ------
A0A0D9R491_BAD-01      ------
A0A2K5M0C1_BAD-01      ------
A0A2K5VCD8_BAD-01      ------
F7GVS7_BAD-01          ------
A0A2K6E7J3_BAD-01      ------
A0A2K5XJR2_BAD-01      ------
A0A2I3MCN5_BAD-04      ------
A0A2K6N1A1_BAD-01      ------
A0A2K6PUM5_BAD-01      ------
A0A2K5HKW9_BAD-01      ------
B4DZQ9_BAD-01          ------
A0A2K6GWV0_BAD-01      ------
F6SJL0_BAD-01          ------
A0A2I3MCN5_BAD-01      ------
A0A2I2Z8C7_BAD-01      ------
A0A2I2Z8C7_BAD-02      ------
Q92934_BAD-01          ------
Q92934_BAD-02          ------
A0A2I3TBK7_BAD-02      ------
A0A2R8Z697_BAD-01      ------
A0A2J8TYJ3_BAD-01      ------
F1PK10_BAD-01          ------
Q45KI9_BAD-01          ------
                             

© 1998-2018