Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

151 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
F6Z067_BAD-01          --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
A0A3Q2QC80_BAD-01      --------------------------------------------------
A0A3Q3MLA0_BAD-02      --------------------------------------------------
A0A3Q3MLA0_BAD-03      ------------------------------------------------MK
I3K7B6_BAD-01          --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WIZ8_BAD-02      --------------------------------------------------
A0A3P8WIZ8_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A3B5K831_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3Q3MLA0_BAD-01      --------------------------------------------------
G1SS60_BAD-01          --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
A0A337SAW2_BAD-01      MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G3VRY4_BAD-02          --------------------------------------------------
G3VRY4_BAD-01          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
I3MBM5_BAD-01          --------------------------------------------------
I3MBM5_BAD-02          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A287AEF3_BAD-02      --------------------------------------------------
A0A3B1JLM2_BAD-01      ----MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWN
A0A452IFQ4_BAD-01      --------------------------------------------------
C1C3S9_BAD-01          -----------------------------------------------MGD
F6Z067_BAD-01          -----------------------------------------------MAD
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------MSTAARAAAGTCDSTAVSQPSKLD
A0A3Q2QC80_BAD-01      ---------MSPSSSSHIGCFPYPLRNQINSSPSCTFISGLNFPNSCLPD
A0A3Q3MLA0_BAD-02      --------------------------------------------------
A0A3Q3MLA0_BAD-03      CNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGVLD
I3K7B6_BAD-01          --------------------------------------------------
A0A3P9B2E4_BAD-01      --------------------------------------------------
A0A3Q3C680_BAD-01      --------------------------------------------------
A0A3P8QRJ7_BAD-01      --------------------------------------------------
A0A3Q4GGN3_BAD-01      --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
A0A3Q2D5S0_BAD-01      -----------------------------------------MAQSVETSD
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A3Q1K1C7_BAD-02      --------------------------------------------------
A0A3Q1K1C7_BAD-01      --------------------------------------------------
A0A3Q1GWH9_BAD-01      --------------------------------------------------
A0A3Q1CPU7_BAD-01      --------------------------------------------------
A0A3P8TWH6_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-01      --------------------------------------------------
A0A3P8WIZ8_BAD-02      ----------------------------------------MNVEVSIFPD
A0A3P8WIZ8_BAD-01      --------------------------------------------------
A0A3P9A5G8_BAD-02      --------------------------------------------------
A0A3P9A5G8_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
A0A3B3QX41_BAD-01      -----------------------------------------------MSG
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3P8Y761_BAD-01      --------------------------------------------------
A0A3B5K831_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3P9Q7C3_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A3Q3AEL8_BAD-02      --------------------------------------------------
A0A3Q3AEL8_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3Q2Y0E4_BAD-01      --------------------------------------------------
A0A3Q3R5S3_BAD-01      --------------------------------------------------
A0A3Q3RXS8_BAD-02      --------------------------------------------------
A0A3Q3RXS8_BAD-01      --------------------------------------------------
A0A3Q0QNQ2_BAD-02      --------------------------------------------------
A0A3Q3WTY4_BAD-01      --------------------------------------------------
A0A3Q3MLA0_BAD-01      -------------------------------------------MTLTASD
G1SS60_BAD-01          --------------------------------------------------
A0A3B4DUY7_BAD-01      -------------------------------------------MSNQYLQ
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G3VRY4_BAD-02          --------------------------------------------------
G3VRY4_BAD-01          --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
A0A452ER54_BAD-02      ------------------------------------------------YR
W5P8G9_BAD-01          --------------------------------------------QGPRYR
G3TP47_BAD-01          ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
G1MI17_BAD-01          -----------VGTPENPSSAPTHGPGKRKSGTDR--RETRKGPRTTALA
A0A287AEF3_BAD-01      -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
M3YNE7_BAD-01          --------------------------------------------------
A0A452RJM6_BAD-01      --------------------------------------------------
A0A384DJL2_BAD-01      --------------------------------------------------
A0A452ER54_BAD-01      -------------------MGTPENPSAAPTTRKLSIRRRRRESGGRQWA
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
F7DN67_BAD-01          ---------MGTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAG
O35147_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          ---------------TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLA
Q45KI9_BAD-01          --------------------------------------------------
I3MBM5_BAD-01          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-02          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-02          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
Q61337_BAD-01          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
                                                                         

F7GVS7_BAD-04          ----------MEEEP-----------------------------------
Q2PG01_BAD-01          ----------MEEEP-----------------------------------
A0A2I3H4B2_BAD-01      ----------MGEEP-----------------------------------
Q6P7C5_BAD-01          PAAQSMFQI-PEFEPSEQEDASTT------DRGL----------------
A0A287AEF3_BAD-02      -----MFQI-PEFEQSEQEDSSPA------DRGL----------------
A0A3B1JLM2_BAD-01      SSGSTVFTMEKTPPHSKEDDISPI--------------------------
A0A452IFQ4_BAD-01      -----MFRI-QEFPDEVFPGRGKE--------------------------
C1C3S9_BAD-01          SPHKSMFSI-EEFPPTE-RGSAFS--------------------------
F6Z067_BAD-01          SSPSAVFKL-EEFDNEE-QGLPLP--------------------------
E7FBJ6_BAD-01          ---------MENTSHDHQDDS------------S----------------
B5XEF1_BAD-01          ----------MDYTHDCVDECESD------HSGT----------------
A0A3B4CPH6_BAD-01      --MAHMFTL--SDDSDTSEDLGDA------DQPE----------------
H3D8J8_BAD-01          --MAAKFSLCSDSDSEPSEEVEEG--------------------------
A0A3B5L9R9_BAD-01      --MDTKFTI-SDGESDPSEDVEE---------------------------
A0A3B1IH05_BAD-01      FTMDHMFTI--SDESDASEELGDS------DQPE----------------
A0A3Q2QC80_BAD-01      DTMAAKFTI-SDSDSEPPEEVEEE------GNDQ----------------
A0A3Q3MLA0_BAD-02      --MAAKFTI-SDSESGSEEEVKEE------ENDQ----------------
A0A3Q3MLA0_BAD-03      VTMAAKFTI-SDSESGSEEEVKEE------ENDQ----------------
I3K7B6_BAD-01          --MAANFTI-SDSESETSEEVGEE------ENQQ----------------
A0A3P9B2E4_BAD-01      --MAANFKI-SDSDSEASEEVGEG------ENQQ----------------
A0A3Q3C680_BAD-01      --MAANFKI-SDSDSEASEEVGEE------ENQQ----------------
A0A3P8QRJ7_BAD-01      --MAANFKI-SDSDSEASEEVGEG------ENQQ----------------
A0A3Q4GGN3_BAD-01      --MAANFKI-SDSDSETSEEVGEG------ENQQ----------------
A0A3B4GXJ6_BAD-01      --MAANFKI-SDSDSEASEEVGEG------ENQQ----------------
A0A3Q2D5S0_BAD-01      PIMAATFTI-SDSDTEPSEEVEET------RNKE----------------
A0A3B3BQF7_BAD-01      --MAAKFSI-SDNDSESSEEVEGG------RLDL----------------
A0A3Q1K1C7_BAD-02      --MAARFTI-SDSDSDPSEGMEEE------GHNQ----------------
A0A3Q1K1C7_BAD-01      --MAARFTI-SDSDSDPSEGMEEE------GHNQ----------------
A0A3Q1GWH9_BAD-01      --MAAKFSI-SDGDSEPEE--VEG------ENNH----------------
A0A3Q1CPU7_BAD-01      --MAAKFTI-SDSESEPSEEVEEG------ENNH----------------
A0A3P8TWH6_BAD-01      --MAAKFTI-SDSESEPSEEVEEG------ENNH----------------
A0A2U9BAC9_BAD-01      --MAANFTI-SDSESEPSEEVEEG------EVSQ----------------
A0A3B4VFC5_BAD-01      --MAANFTI-SDSESEPSEEVDEG------EMSQ----------------
A0A3B4W9T1_BAD-01      --MAANFTI-SDSESEPSEEVDEG------EMSQ----------------
A0A3Q0QNQ2_BAD-01      --FIHFLPF-IQGRGQQPSHL----------LQL----------------
A0A3P8WIZ8_BAD-02      VTMAAQFTI-SDSESEPEEEVEGG------KIKH----------------
A0A3P8WIZ8_BAD-01      --MAAQFTI-SDSESEPEEEVEGG------KIKH----------------
A0A3P9A5G8_BAD-02      --MAFKMDHTQDCVGDIPENINEK------YDLD----------------
A0A3P9A5G8_BAD-01      --MAFKMDHTQDCVGDIPENINEK------YDLD----------------
B5X1T1_BAD-01          ------MDHTHDCVDDNPETMNEH------DESD----------------
H3ANP3_BAD-03          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGR----------------
H3ANP3_BAD-04          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGR----------------
H3ANP3_BAD-02          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGR----------------
H3ANP3_BAD-01          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGR----------------
A0A3B3QX41_BAD-01      VTMAHMFTISGNESDTSESDTPDV------TANS----------------
Q4V925_BAD-02          --MAHMFNISDDSETETMEDSEDS------SLDK----------------
Q4V925_BAD-03          --MAHMFNISDDSETETMEDSEDS------SLDK----------------
A7MCM4_BAD-01          --MAHMFNISDDSETETMEDSEAS------SLDK----------------
Q4V925_BAD-04          --MAHMFNISDDSETETMEDSEDS------SLDK----------------
Q4V925_BAD-01          --MAHMFNISDDSETETMEDSEDS------SLDK----------------
A0A3P8Y761_BAD-01      --MENIFTI-SDTESESSDVEETK------KEWI----------------
A0A3B5K831_BAD-01      --MATRFSISSDSDSDPSEEVDEG------ERNS----------------
A0A3B5Q2N7_BAD-01      --MDTKFTI-SDGESDPSEDVEER------GDLQ----------------
A0A087X8P8_BAD-01      --MDAKFTI-SDSDSEPSEDVEER------GNLQ----------------
A0A3B3UA11_BAD-01      --MDAKFTI-SDSDSEPSEDVEER------GNLQ----------------
A0A3B3YFR1_BAD-01      --MDAKFTI-SDSDSEPSEDVEER------GNLQ----------------
A0A3P9Q7C3_BAD-01      --MDAKFTI-SDSDSEPSEDVEER------GNLQ----------------
A0A3B3HDU2_BAD-01      --MAAKFTI-SD-DSESSEEVEGG------KLDL----------------
A0A3B5BAL2_BAD-01      --MAAQFSI-SGSESDP-EEVEEG------ENNH----------------
A0A3Q3AEL8_BAD-02      --MAAKFTI-SDSESEPSDEVEEG------KSKQ----------------
A0A3Q3AEL8_BAD-01      --MAAKFTI-SDSESEPSDEVEEG------KSKQ----------------
G3Q8B3_BAD-01          --MAAHFTI-SDSESEPSDGVEER------EDGQ----------------
A0A3Q2Y0E4_BAD-01      --MAANFSI-SDSESEPSEEVEEG------DDGQ----------------
A0A3Q3R5S3_BAD-01      --MAANFTI-SDSESESSEEVEEG------KHSQ----------------
A0A3Q3RXS8_BAD-02      --MAAKFS-ISESESDSSEEVEGG------KQKK----------------
A0A3Q3RXS8_BAD-01      --MAAKFS-ISESESDSSEEVEGG------KQKK----------------
A0A3Q0QNQ2_BAD-02      ---------MPEPPRLVLFDVEEG------QSPF----------------
A0A3Q3WTY4_BAD-01      --MATNFTISSDSESELSEEIEEG------ENSQ----------------
A0A3Q3MLA0_BAD-01      VTMAAKFTI-SDSESGSEEEVKEE------EN------------------
G1SS60_BAD-01          --------------------------------------------------
A0A3B4DUY7_BAD-01      KLRRARFNC-EEERYKKVIKTLTG------EKGTPFNPLCWNSLRTTACA
A0A337SAW2_BAD-01      AWAQSMFQI-PEFEPSEQEDSSPT------DRGL----------------
A0A2I3TBK7_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2R8Z697_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I2Z8C7_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
Q92934_BAD-03          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5M0C1_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5XJR2_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3MCN5_BAD-03      -----MFQI-PEFEPSEQEDSRSA------ERGL----------------
A0A2K5VCD8_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
F7GVS7_BAD-02          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6E7J3_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5E6K7_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6TG62_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5E6K7_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5HKW9_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6N1A1_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6PUM5_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5M0C1_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5VCD8_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
F7GVS7_BAD-03          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5XJR2_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3MCN5_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6E7J3_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I2Z8C7_BAD-04      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
Q92934_BAD-04          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3TBK7_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2R8Z697_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
F6SJL0_BAD-02          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6TG62_BAD-03      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
G3VRY4_BAD-02          -----MFQI-SEFEPSEPGEDPSA------STAP----------------
G3VRY4_BAD-01          -----MFQI-SEFEPSEPGEDPSA------STAP----------------
G1P8C5_BAD-01          PTAQSMFQI-PEFEHSEQEDSSPA------DRGL----------------
A0A452ER54_BAD-02      AWAQSMFQI-PEFEQSEQEDSSPA------DRGL----------------
W5P8G9_BAD-01          AWAQSMFQI-PEFEQSEQEDSSPA------DRGL----------------
G3TP47_BAD-01          GGLQSMFQI-PEFEQSDREDSTPA------DRGL----------------
G1MI17_BAD-01          PTAQSMFQI-PEFEPSEQEDSSPA------DRGL----------------
A0A287AEF3_BAD-01      PASQSMFQI-PEFEQSEQEDSSPA------DRGL----------------
M3YNE7_BAD-01          -----MFQI-PEFEPSEQEDSSPA------DRGL----------------
A0A452RJM6_BAD-01      -----MFQI-PEFEPSEQEDSSPA------DRGL----------------
A0A384DJL2_BAD-01      -----MFQI-PEFEPSEQEDSSPA------DRGL----------------
A0A452ER54_BAD-01      GPRGSMFQI-PEFEQSEQEDSSPA------DRGL----------------
F1MUT9_BAD-01          -----MFQI-PEFEQSEQEDSSPA------DRGL----------------
Q3SYZ0_BAD-01          -----MFQI-PEFEQSEQEDSSRA------DRGL----------------
F7DN67_BAD-01          PAAGSMFQI-PEFEQSEPEDSSPA------DRGL----------------
O35147_BAD-01          PAAQSMFQI-PEFEPSEQEDASTT------DRGL----------------
H0WVR2_BAD-01          -----MFQI-PEFEPSEQEDSSSS------DRGL----------------
H0V608_BAD-01          -----MFQI-PEFEPSEQEDSSSE------ERGL----------------
A0A2K5E6K7_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6TG62_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A0D9R491_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5M0C1_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5VCD8_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
F7GVS7_BAD-01          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6E7J3_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5XJR2_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3MCN5_BAD-04      -----MFQI-PEFEPSEQEDSRSA------ERGL----------------
A0A2K6N1A1_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6PUM5_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K5HKW9_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
B4DZQ9_BAD-01          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2K6GWV0_BAD-01      -----MFQI-PEFEPSEQEDSSSA------GRGL----------------
F6SJL0_BAD-01          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3MCN5_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I2Z8C7_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I2Z8C7_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
Q92934_BAD-01          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
Q92934_BAD-02          -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2I3TBK7_BAD-02      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2R8Z697_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
A0A2J8TYJ3_BAD-01      -----MFQI-PEFEPSEQEDSSSA------ERGL----------------
F1PK10_BAD-01          PTAQSMFQI-PEFEPSEQEDSSPA------NRGL----------------
Q45KI9_BAD-01          -----MFQI-PEFEPSEQEDSSPA------NRGL----------------
I3MBM5_BAD-01          AWTQSMFQI-PEFEPSEQEDSSSA------EGGL----------------
I3MBM5_BAD-02          AWTQSMFQI-PEFEPSEQEDSSSA------EGGL----------------
Q61337_BAD-05          -----MFQI-PEFEPSEQEDASAT------DRGL----------------
Q61337_BAD-04          -----MFQI-PEFEPSEQEDASAT------DRGL----------------
Q61337_BAD-03          -----MFQI-PEFEPSEQEDASAT------DRGL----------------
Q61337_BAD-06          -----MFQI-PEFEPSEQEDASAT------DRGL----------------
Q61337_BAD-02          A-AQSMFQI-PEFEPSEQEDASAT------DRGL----------------
Q61337_BAD-01          A-AQSMFQI-PEFEPSEQEDASAT------DRGL----------------
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------GPSLTE---DQP------------
A0A287AEF3_BAD-02      --------------------------GPSPTG---TDP------------
A0A3B1JLM2_BAD-01      --------------------------DDHDESRWSEAVKSVDSPQTDSGP
A0A452IFQ4_BAD-01      --------------------------APAPPE-----SQRGHTPGSKQPD
C1C3S9_BAD-01          --------------------------GTNPPG-----FGG--DPGHKSSP
F6Z067_BAD-01          --------------------------FVDPPR-----GAGVRQPVAKSSP
E7FBJ6_BAD-01          --------------------------TLDEKERSHLKGTIKNHGQHQDRT
B5XEF1_BAD-01          --------------------------TRNSEFQLHVSTTMSNRPR-----
A0A3B4CPH6_BAD-01      --------------------------ASKRAE------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------VSKTAE-------PSRSGQHITVP
A0A3Q2QC80_BAD-01      --------------------------PADGKV------EPLRQRHALTLP
A0A3Q3MLA0_BAD-02      --------------------------SSAVEE------PHVPQRHSLTLP
A0A3Q3MLA0_BAD-03      --------------------------SSAVEE------PHVPQRHSLTLP
I3K7B6_BAD-01          --------------------------PAGQDQ--------ESKPQTLALP
A0A3P9B2E4_BAD-01      --------------------------SAGQAQ--------ESKPQTLSLP
A0A3Q3C680_BAD-01      --------------------------SAGQAQ--------ESKPQTLSLP
A0A3P8QRJ7_BAD-01      --------------------------SAGQAQ--------ESKPQTLSLP
A0A3Q4GGN3_BAD-01      --------------------------SARQVQ--------ESKPQTLSLP
A0A3B4GXJ6_BAD-01      --------------------------SAGQAQ--------ESKPQTLSLP
A0A3Q2D5S0_BAD-01      -------------------------------------------------P
A0A3B3BQF7_BAD-01      --------------------------AASGGEGGGGGGGHLHDRHALTLP
A0A3Q1K1C7_BAD-02      --------------------------SPPGQE------QQVFPRHTLTLP
A0A3Q1K1C7_BAD-01      --------------------------SPPGQE------QQVFPRHTLTLP
A0A3Q1GWH9_BAD-01      --------------------------SPATEA------MPVFARRNMALP
A0A3Q1CPU7_BAD-01      --------------------------SPATQA------MPVFARRNMALP
A0A3P8TWH6_BAD-01      --------------------------SPATQA------MPVFARRNMALP
A0A2U9BAC9_BAD-01      --------------------------PWTGPG------EQVPPRHTLALP
A0A3B4VFC5_BAD-01      --------------------------SLTGQE------QELSQRHTLTLP
A0A3B4W9T1_BAD-01      --------------------------SLTGQE------QELSQRHTLTLP
A0A3Q0QNQ2_BAD-01      --------------------------IWGTPR------HSQAIGHDQNTS
A0A3P8WIZ8_BAD-02      --------------------------SLNDPE------QVVPHRHNLTLP
A0A3P8WIZ8_BAD-01      --------------------------SLNDPE------QVVPHRHNLTLP
A0A3P9A5G8_BAD-02      --------------------------HLGTTH---YP---EFQFCNTSTN
A0A3P9A5G8_BAD-01      --------------------------HLGTTH---YP---EFQFCNTSTN
B5X1T1_BAD-01          --------------------------HSGTTH---YP---EFQRHYVSTR
H3ANP3_BAD-03          --------------------------GEGSEP---SEKTAGLKKHSRTAP
H3ANP3_BAD-04          --------------------------GEGSEP---SEKTAGLKKHSRTAP
H3ANP3_BAD-02          --------------------------GEGSEP---SEKTAGLKKHSRTAP
H3ANP3_BAD-01          --------------------------GEGSEP---SEKTAGLKKHSRTAP
A0A3B3QX41_BAD-01      --------------------------QLGNNL---KN-------------
Q4V925_BAD-02          --------------------------HKSGSA---QK------KQHLTVP
Q4V925_BAD-03          --------------------------HKSGSA---QK------KQHLTVP
A7MCM4_BAD-01          --------------------------HKSGSA---QK------KQHLTVP
Q4V925_BAD-04          --------------------------HKSGSA---QK------KQHLTVP
Q4V925_BAD-01          --------------------------HKSGSA---QK------KQHLTVP
A0A3P8Y761_BAD-01      --------------------------AGQGKT---GS----RLGLSLNLP
A0A3B5K831_BAD-01      --------------------------SLSEQE---RQ--V-LQRHTLTLP
A0A3B5Q2N7_BAD-01      --------------------------LMQEKE---KP--L-SQRHTLTLP
A0A087X8P8_BAD-01      --------------------------LMQVKE---RP--L-SQRHTLTLP
A0A3B3UA11_BAD-01      --------------------------LMQVKE---RP--L-SQRHTLTLP
A0A3B3YFR1_BAD-01      --------------------------LMQVKE---RP--L-SQRHTLTLP
A0A3P9Q7C3_BAD-01      --------------------------LMQVKE---RP--L-SQRHTLTLP
A0A3B3HDU2_BAD-01      --------------------------GAAAGG---EGEHL-HDRHSLTLP
A0A3B5BAL2_BAD-01      --------------------------PPAEQP---MH--V-FERRNLALP
A0A3Q3AEL8_BAD-02      --------------------------PAAGPE---DG-----VRQRLTLP
A0A3Q3AEL8_BAD-01      --------------------------PAAGPE---DG-----VRQRLTLP
G3Q8B3_BAD-01          --------------------------LSSGQE---QQ--R-LQRHTLTLP
A0A3Q2Y0E4_BAD-01      --------------------------GAAEKE---QEQCL-RQGLRLTLP
A0A3Q3R5S3_BAD-01      --------------------------SSTSQE---QQ--V-PPCHSLTLP
A0A3Q3RXS8_BAD-02      --------------------------SSARQE---QQ--V-SQRHALALP
A0A3Q3RXS8_BAD-01      --------------------------SSARQE---QQ--V-SQRHALALP
A0A3Q0QNQ2_BAD-02      --------------------------REGSFL---LL--VSVISFFWSLP
A0A3Q3WTY4_BAD-01      --------------------------LQTEQE---QQ--V-FQRHTLTLP
A0A3Q3MLA0_BAD-01      --------------------------DQSSAV---EEP-HVPQRHSLTLP
G1SS60_BAD-01          --------------------------------------------------
A0A3B4DUY7_BAD-01      MEKHSEDGISTMDDQDESNWSETVKNGDSPQL---DSQHSMASNISPASP
A0A337SAW2_BAD-01      --------------------------GPSPTG---DRP-RGPGKHQRTTP
A0A2I3TBK7_BAD-01      --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2R8Z697_BAD-02      --------------------------GPSPAG---DGP-SGSSKHHRQAP
A0A2I2Z8C7_BAD-03      --------------------------GPSPAG---DGP-SGSGKHHRQAP
Q92934_BAD-03          --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2K5M0C1_BAD-02      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2K5XJR2_BAD-02      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2I3MCN5_BAD-03      --------------------------GPSPAG---DKP-SDSGKHHRQAP
A0A2K5VCD8_BAD-02      --------------------------GPSPAG---DRP-SDSGKHHRQAP
F7GVS7_BAD-02          --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K6E7J3_BAD-02      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K5E6K7_BAD-02      --------------------------SPSTAG---DRP-PGSGKHPRQAP
A0A2K6TG62_BAD-02      --------------------------SPSTAG---DSP-PGSGKHRRQAP
A0A2K5E6K7_BAD-03      --------------------------SPSTAG---DRP-PGSGKHPRQAP
A0A2K5HKW9_BAD-02      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K6N1A1_BAD-02      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K6PUM5_BAD-02      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K5M0C1_BAD-03      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2K5VCD8_BAD-03      --------------------------GPSPAG---DRP-SDSGKHHRQAP
F7GVS7_BAD-03          --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K5XJR2_BAD-03      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2I3MCN5_BAD-02      --------------------------GPSPAG---DKP-SDSGKHHRQAP
A0A2K6E7J3_BAD-03      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2I2Z8C7_BAD-04      --------------------------GPSPAG---DGP-SGSGKHHRQAP
Q92934_BAD-04          --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2I3TBK7_BAD-03      --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2R8Z697_BAD-03      --------------------------GPSPAG---DGP-SGSSKHHRQAP
F6SJL0_BAD-02          --------------------------SPSTAG---DRP-PGSGKHRRQAP
A0A2K6TG62_BAD-03      --------------------------SPSTAG---DSP-PGSGKHRRQAP
G3VRY4_BAD-02          --------------------------SLAPLR---PGPRAAPGAHHHEKG
G3VRY4_BAD-01          --------------------------SLAPLR---PGPRAAPGAHHHEGA
G1P8C5_BAD-01          --------------------------GPCPTG---DQP-PGLNKHWSTVP
A0A452ER54_BAD-02      --------------------------GPSPTG---DRP-PGLSKHWLTAP
W5P8G9_BAD-01          --------------------------GPSPTG---DRP-PGLSKHWLTAP
G3TP47_BAD-01          --------------------------GPSPEG---YWP-SGPSDRHRVAP
G1MI17_BAD-01          --------------------------GPSPTG---DQP-PGPGKHRQTAP
A0A287AEF3_BAD-01      --------------------------GPSPTG---TDP-----QPWRTAP
M3YNE7_BAD-01          --------------------------GPSPTG---DQP-PGLGKHLQTAP
A0A452RJM6_BAD-01      --------------------------GPSPTG---DQP-PGPGKHRQTAP
A0A384DJL2_BAD-01      --------------------------GPSPTG---DQP-PGPGKHRQTAP
A0A452ER54_BAD-01      --------------------------GPSPTG---DRP-PGLT------P
F1MUT9_BAD-01          --------------------------GPSPTG---DRP-PGLSKHWLTAP
Q3SYZ0_BAD-01          --------------------------GPSPTG---DRP-PGLSKHWLTAP
F7DN67_BAD-01          --------------------------GPSPTG---DWP-SDPVRHQRTAP
O35147_BAD-01          --------------------------GPSLTE---DQP-G-----PYLAP
H0WVR2_BAD-01          --------------------------GPSPSG---DQP-LGPGKNRCTTP
H0V608_BAD-01          --------------------------GPSPTG---DEL-GSS-----PAG
A0A2K5E6K7_BAD-01      --------------------------SPSTAG---DRP-PGSGKHPRQAP
A0A2K6TG62_BAD-01      --------------------------SPSTAG---DSP-PGSGKHRRQAP
A0A0D9R491_BAD-01      --------------------------GPSPAG---NRP-SDSGKHHHQAP
A0A2K5M0C1_BAD-01      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2K5VCD8_BAD-01      --------------------------GPSPAG---DRP-SDSGKHHRQAP
F7GVS7_BAD-01          --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K6E7J3_BAD-01      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K5XJR2_BAD-01      --------------------------GPSLAG---DRP-SDCGKHHRQAP
A0A2I3MCN5_BAD-04      --------------------------GPSPAG---DKP-SDSGKHHRQAP
A0A2K6N1A1_BAD-01      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K6PUM5_BAD-01      --------------------------GPSPAG---DRP-SDSGKHHRQAP
A0A2K5HKW9_BAD-01      --------------------------GPSPAG---DRP-SDSGKHHRQAP
B4DZQ9_BAD-01          --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2K6GWV0_BAD-01      --------------------------GPSPSG---DRP-SGPGKHPCTAP
F6SJL0_BAD-01          --------------------------SPSTAG---DRP-PGSGKHRRQAP
A0A2I3MCN5_BAD-01      --------------------------GPSPAG---DKP-SDSGKHHRQAP
A0A2I2Z8C7_BAD-02      --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2I2Z8C7_BAD-01      --------------------------GPSPAG---DGP-SGSGKHHRQAP
Q92934_BAD-01          --------------------------GPSPAG---DGP-SGSGKHHRQAP
Q92934_BAD-02          --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2I3TBK7_BAD-02      --------------------------GPSPAG---DGP-SGSGKHHRQAP
A0A2R8Z697_BAD-01      --------------------------GPSPAG---DGP-SGSSKHHRQAP
A0A2J8TYJ3_BAD-01      --------------------------GPSPAG---DRP-SGSSKHHRQAP
F1PK10_BAD-01          --------------------------GPSPTG---DRP-PSPGKHQQTAP
Q45KI9_BAD-01          --------------------------GPSPTG---DRP-PSPGKHQQTAP
I3MBM5_BAD-01          --------------------------GPSPAG---DRP-G-----CGLAP
I3MBM5_BAD-02          --------------------------GPSPAG---DRP-G-----CGLAP
Q61337_BAD-05          --------------------------GPSLTE---DQP-G-----PYLAP
Q61337_BAD-04          --------------------------GPSLTE---DQP-G-----PYLAP
Q61337_BAD-03          --------------------------GPSLTE---DQP-G-----PYLAP
Q61337_BAD-06          --------------------------GPSLTE---DQP-G-----PYLAP
Q61337_BAD-02          --------------------------GPSLTE---DQP-G-----PYLAP
Q61337_BAD-01          --------------------------GPSLTE---DQP-G-----PYLAP
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
A0A3B1JLM2_BAD-01      SMYRDTSSDELLEVGGRVRLY-SESQVY-----------NINRWEDNENQ
A0A452IFQ4_BAD-01      T----PTAEVRSRIGSDTPSL-----------------------------
C1C3S9_BAD-01          NLRRIKGKETRQRTESASEAS-----------------------------
F6Z067_BAD-01          SLRRYPGKESRLRTESASESS-----------------------------
E7FBJ6_BAD-01          SAN-ISPQGRVR-LYSESQVY-T-VSRW--------QDTETQD--GASVE
B5XEF1_BAD-01          ------PGERVR-LYSESQVR-SQVGKR--------EDTEFQDVMTPTEE
A0A3B4CPH6_BAD-01      ----LSQSGQHP-LVPERFRE-SRQRNH--------------SMNEDALQ
H3D8J8_BAD-01          ERGSFSTSGRIR-VNSESQAS-AVSRDE-----------ELQGNGDD--E
A0A3B5L9R9_BAD-01      -------RGDLQ-LMQEKEKP-LSQRHTLTLPELRSTKVELQARGEE--E
A0A3B1IH05_BAD-01      E--------KLR-VEPRQRNF-SMNEEA--------LQESGAGRHED---
A0A3Q2QC80_BAD-01      ELR--SGHGRIR-LNSESHAS-TISREE-----------ELQGRAEE--E
A0A3Q3MLA0_BAD-02      ELR-LAGTGRIR-LNSESHAY-TVSRDE-----------ELQARGEE--E
A0A3Q3MLA0_BAD-03      ELR-LAGTGRIR-LNSESHAY-TVSRDE-----------ELQARGEE--E
I3K7B6_BAD-01          VIK-TT-------VQPNQWNA-LGMRDE-----------DLMARGED--E
A0A3P9B2E4_BAD-01      VTK-TTAAGRLR-VNSESHTS-SIARDE-----------ELMARGED--E
A0A3Q3C680_BAD-01      VIK-TTAAGRLR-VNSESHTS-SIARDE-----------ELMARGED--E
A0A3P8QRJ7_BAD-01      VTK-TTAAGRLR-VNSESHTS-SIARDE-----------ELMARGED--E
A0A3Q4GGN3_BAD-01      VIK-TTAAGRLR-VNSESHTS-SIARDE-----------ELMARGED--E
A0A3B4GXJ6_BAD-01      VIK-TTAAGRLR-VNSESHTS-SIARDE-----------ELMARGED--E
A0A3Q2D5S0_BAD-01      RIR-NSGKTHRR-IRLSSESH-AFTREE-----------E--ARGEE--E
A0A3B3BQF7_BAD-01      ELR-LTSNGRTR-LNSESTVS-TYSRDE-----------DLPR--ED--E
A0A3Q1K1C7_BAD-02      ELR---ASGRIR-LNSESHAS-TVYRDE-----------ELQAKADE--E
A0A3Q1K1C7_BAD-01      ELR---ASGRIR-LNSESHAS-TVYRDE-----------ELQAKADE--E
A0A3Q1GWH9_BAD-01      ELR-TPASGRIR-LNSESHAS-TLSRDE-----------ELQAKGEE--E
A0A3Q1CPU7_BAD-01      ELR-TPASGRLR-LNSESHAS-TLSRDE-----------ELQARGEE--E
A0A3P8TWH6_BAD-01      ELR-TPASGRLR-LNSESHAS-TLSRDE-----------ELQARGEE--E
A0A2U9BAC9_BAD-01      ELR-MAATGRIR-LNSESNAS-TLSRDE-----------ELLTRWDE--E
A0A3B4VFC5_BAD-01      ELR-GAATGRTR-LNSESHTS-TVSRDE-----------EFQARGEE--E
A0A3B4W9T1_BAD-01      ELR-GAATGRTR-LNSESHTS-TVSRDE-----------EFQARGEE--E
A0A3Q0QNQ2_BAD-01      PMR-HPTARRIR-MNSESHTS-SVSRDE-----------ELVVRGED--E
A0A3P8WIZ8_BAD-02      ELR-VAGSRRIR-LNSESHAS-TISREE-----------AFQSWGEE--E
A0A3P8WIZ8_BAD-01      ELR-VAGSRRIR-LNSESHAS-TISREE-----------AFQSWGEE--E
A0A3P9A5G8_BAD-02      TSNRTLPGVRVR-LYSESQVC-SQVGRQ--------DNTEFQVAMTPTEE
A0A3P9A5G8_BAD-01      TSNRTLPGVRVR-LYSESQVC-SQVGRQ--------DNTEFQVAMTPTEE
B5X1T1_BAD-01          TGIRPRPGGRVR-LYSESQVC-SQVGRR--------DNTEFQDVMTPTEE
H3ANP3_BAD-03          NLQ-NPGPHQSH-PPSHTGVY-GWVKLR--------KRNNMEILGRP--S
H3ANP3_BAD-04          NLQ-NPGPHQSH-PPSHTVFW-GFT-------------DNMEILGRP--S
H3ANP3_BAD-02          NLQ-NPGPHQSH-PPSH-------T-------------DNMEILGRP--S
H3ANP3_BAD-01          NLQ-NPGPHQSH-PPSH-------T-------------DNMEILGRP--S
A0A3B3QX41_BAD-01      TKNPGEAGGRVR-MRSESQVS-SIRSED--------L--DFGEGGAS--E
Q4V925_BAD-02          DRLKGEQLGRQR---------------------------NLSMNEEDLLE
Q4V925_BAD-03          DRLKGEQLGRQR---------------------------NLSMNEEDLLE
A7MCM4_BAD-01          DRLKGEQLGRQR---------------------------NLSMNEEDLLE
Q4V925_BAD-04          DRLKGEQLGRQR---------------------------NLSMNEEDLLE
Q4V925_BAD-01          DRLKGEQLGRQR---------------------------NLSMNEEDLLE
A0A3P8Y761_BAD-01      ------GEGRIR-LNSESQVF-ATSGGE--------RSGELQGLGQG--L
A0A3B5K831_BAD-01      ELR-LTGTSRTR-VSSESQAS-TFSR-E--------E--ELQGNVED--E
A0A3B5Q2N7_BAD-01      ELR--STTGRVR-LNSESIAS-TISR-E--------V--ELQARGEE--E
A0A087X8P8_BAD-01      ELR--STTGRVR-LNSESIAS-TISR-E--------E--ELQARGEE--E
A0A3B3UA11_BAD-01      ELR--STTGRVR-LNSESIAS-TISR-E--------E--ELQARGEE--E
A0A3B3YFR1_BAD-01      ELR--STTGRVR-LNSESIAS-TISR-E--------E--ELQARGEE--E
A0A3P9Q7C3_BAD-01      ELR--STTGRVR-LNSESIAS-TISR-E--------E--ELQARGEE--E
A0A3B3HDU2_BAD-01      ELR-LTSNGRTR-LNSESTAS-TYSRDE-------------DLARED--E
A0A3B5BAL2_BAD-01      ELR-TPAAGRIR-LNSESHAT-TVSR-D--------E--ELQARGEE--E
A0A3Q3AEL8_BAD-02      ELR-HSKNGRLR-VNSESLSS-TSSRGE--------E--ELPARADD--E
A0A3Q3AEL8_BAD-01      ELR-HSKNGRLR-VNSESLSS-TSSRGE--------E--ELPARADD--E
G3Q8B3_BAD-01          ELRLSGRKSQRI-VEKE------------------------EELWLD--E
A0A3Q2Y0E4_BAD-01      ELPMEAMSGRIR-LNSESHAL-AVSR-E--------E--EFQARVDE--E
A0A3Q3R5S3_BAD-01      ELRMAATS-RNR-VSSESNAS-TVQ----------------DAKSDE--E
A0A3Q3RXS8_BAD-02      ELR--------------TTAS-NRIRLS--------S--ESQSRVDE--E
A0A3Q3RXS8_BAD-01      ELR--------------TTAS-NRIRLS--------S--ESQSRVDE--E
A0A3Q0QNQ2_BAD-02      KAF--------------SR--------D--------E--ELVVRGED--E
A0A3Q3WTY4_BAD-01      ELR--------------MA--------G--------R--TLQVKGED--E
A0A3Q3MLA0_BAD-01      ELRLAGTGRIRLNSESHAYTV----------------------SRDEELQ
G1SS60_BAD-01          -------------PRPKPLSA-GAGAME-----------TR--SRHSSYP
A0A3B4DUY7_BAD-01      DELSEVGCRVRLYSESQVYTV----------------------SRWQDNE
A0A337SAW2_BAD-01      GLLGEAGHQQGQ-PASSNHHG-GAGAVE-----------TR--SRHSSYP
A0A2I3TBK7_BAD-01      GLLWDASHQQEQ-PTSSSHHG-EGT--S-----------SPEERGHSNPD
A0A2R8Z697_BAD-02      GLLWDASHQQEQ-PTSSSHHG-EGT--S-----------SPEERGHSNAD
A0A2I2Z8C7_BAD-03      GLLWDASHQQEQ-PTSSSHHG-EGT--S-----------SPEERRHSNAD
Q92934_BAD-03          GLLWDASHQQEQ-PTSSSHHG-EGT--S-----------SPEERGHSNAD
A0A2K5M0C1_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
A0A2K5XJR2_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
A0A2I3MCN5_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
A0A2K5VCD8_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
F7GVS7_BAD-02          GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
A0A2K6E7J3_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GT---S-----------SPEERGHSDAD
A0A2K5E6K7_BAD-02      GLPGDASHQQGQ-PTSSSHHG-GT---S-----------SPEERGHSNAD
A0A2K6TG62_BAD-02      GLPGDASHQQGQ-PTSSSHHG-GT---S-----------SPEERGHSNAD
A0A2K5E6K7_BAD-03      GLPGDASHQQGQ-PTSSSHHG-GE--YS-----------TCASASSSENP
A0A2K5HKW9_BAD-02      GLLWDASHQQEQ-ATSSSHHG-GRAWYS-----------PS-ESEDSENP
A0A2K6N1A1_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GRAWYY-----------PA-ESEDSENP
A0A2K6PUM5_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GRAWYY-----------PA-ESEDSENP
A0A2K5M0C1_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GGAWYS-----------PSWESEDSENP
A0A2K5VCD8_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GRAWYS-----------PSWESEDSENP
F7GVS7_BAD-03          GLLWDASHQQEQ-PTSSSHHG-GRAWYS-----------PSWESEDSENP
A0A2K5XJR2_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GGAWYS-----------PSWESEDSENP
A0A2I3MCN5_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GRAWYS-----------PSWESEDSENP
A0A2K6E7J3_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GRAWYS-----------PSWESEDSENP
A0A2I2Z8C7_BAD-04      GLLWDASHQQEQ-PTSSSHHG-GRTSYS-----------PSWESEDSENP
Q92934_BAD-04          GLLWDASHQQEQ-PTSSSHHG-GRTSYS-----------PSWESEDSENP
A0A2I3TBK7_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GRTSYS-----------PSWESEDSENP
A0A2R8Z697_BAD-03      GLLWDASHQQEQ-PTSSSHHG-GRTSYS-----------PSWESEDSENP
F6SJL0_BAD-02          GLPGDASHQQGQ-STSSSHHG--------------------------ENP
A0A2K6TG62_BAD-03      GLPGDASHQQGQ-PTSSSHHG--------------------------ENP
G3VRY4_BAD-02          GAQKSQTHVSKELKASASQGRLGKGSFE-----------GREGSREASPE
G3VRY4_BAD-01          GAGRPRLISYPPL---------------------------REGSREASPE
G1P8C5_BAD-01          GLLGEAGHQQGQ-PASSSHHD-GAGSVE-----------PR--SRHSSYP
A0A452ER54_BAD-02      GLLGEAGHQQGQ-PAGSSHHG-GTGAVE-----------TR--SRHSSYP
W5P8G9_BAD-01          GLLGEAGHQQGQ-PAGSSHHG-GTGAVE-----------TR--SRHSSYP
G3TP47_BAD-01          GFLRDSSHQQGQ-PTSSGHHG-GAAAVE-----------TR--SRHSSYP
G1MI17_BAD-01          GLLGEAAHPQGQ-PASSNHHG-GAGAVE-----------PR--SRHSSYP
A0A287AEF3_BAD-01      GHLGEAGHQQGQ-PASSSHHG-GAGAVE-----------TR--SRHSSYP
M3YNE7_BAD-01          GLLGEAGHQQGQ-PASSSHHG-GAGAVE-----------TR--SRHSSYP
A0A452RJM6_BAD-01      GLLGEAAQPQGQ-PASSNHHG-GAGAVE-----------PR--SRHSSYP
A0A384DJL2_BAD-01      GLLGEAAHPQGQ-PASSNHHG-GAGAVE-----------PR--SRHSSYP
A0A452ER54_BAD-01      GLLGEAGHQQGQ-PAGSSHHG-GTGAVE-----------TR--SRHSSYP
F1MUT9_BAD-01          GLLGEAGHQQGQ-PAGSSHHG-GTGAVE-----------TR--SRHSSYR
Q3SYZ0_BAD-01          GLLGEAGHQQGQ-PAGSSHHG-GTGAVE-----------TR--SRHSSYR
F7DN67_BAD-01          GLLGEAGHQQGQ-PASSSHHG-GAGAVE-----------TR--SRHSSYP
O35147_BAD-01          GLLGSIVQQQPGQAANNSHHG-GAGTME-----------TR--SRHSSYP
H0WVR2_BAD-01          SLLGDASHLQGQ-PASNTHHGAGPGAVE-----------TR--SRHSSYP
H0V608_BAD-01          GFLGDTSHQQRQLRSSRSHHG-GTVAME-----------TR--SRHRSYP
A0A2K5E6K7_BAD-01      GLPGDASHQQGQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K6TG62_BAD-01      GLPGDASHQQGQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A0D9R491_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K5M0C1_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K5VCD8_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
F7GVS7_BAD-01          GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K6E7J3_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K5XJR2_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2I3MCN5_BAD-04      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K6N1A1_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K6PUM5_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2K5HKW9_BAD-01      GLLWDASHQQEQ-ATSSSHHG-GAGAVE-----------TR--SRHSSHP
B4DZQ9_BAD-01          GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
A0A2K6GWV0_BAD-01      SFLGDASHQQGQ-PSSSSHHG-GAGSVE-----------TR--SRHSSYP
F6SJL0_BAD-01          GLPGDASHQQGQ-STSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2I3MCN5_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------TR--SRHSSYP
A0A2I2Z8C7_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
A0A2I2Z8C7_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
Q92934_BAD-01          GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
Q92934_BAD-02          GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
A0A2I3TBK7_BAD-02      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
A0A2R8Z697_BAD-01      GLLWDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
A0A2J8TYJ3_BAD-01      GLLRDASHQQEQ-PTSSSHHG-GAGAVE-----------IR--SRHSSYP
F1PK10_BAD-01          GLLGEAGHQQGQ-PASRKHHG-GAGA-E-----------TR--SRHSSFP
Q45KI9_BAD-01          GLLGEAGHQQGQ-PASRKHHG-GAGA-E-----------TR--SRHSSFP
I3MBM5_BAD-01          GLPRDTGHQQWQ-ATSSSNHG-GAGATE-----------TR--SRHSSYP
I3MBM5_BAD-02          GLPRDTGHQQWQ-ATSSSNHG-GAGATE-----------TR--SRHSSYP
Q61337_BAD-05          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
Q61337_BAD-04          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
Q61337_BAD-03          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
Q61337_BAD-06          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
Q61337_BAD-02          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
Q61337_BAD-01          GLLGSNIHQQGR-AATNSHHG-GAGAME-----------TR--SRHSSYP
                                                                         

F7GVS7_BAD-04          --------------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
Q2PG01_BAD-01          --------------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2I3H4B2_BAD-01      --------------SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
Q6P7C5_BAD-01          --------------------GPYLAPG-----LLGSIVQQ----------
A0A287AEF3_BAD-02      --------------------QAPASPGARPQATWGKLVTSRGSRPAAATM
A0A3B1JLM2_BAD-01      DGASAEDGGVGD-GAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD
A0A452IFQ4_BAD-01      -----EPEVQDEPGGAFRARSRSAPPILWAAMRYGRELRRMSDEFDVALQ
C1C3S9_BAD-01          -----ETDSVGEL-QHFRSRSRSAPSSLMVAARYGRELRRMSDEFDQIFT
F6Z067_BAD-01          -----ETDKVGEL-HPFRSRSRSAPSS-MIATKYGRELRRMSDEFEKSFT
E7FBJ6_BAD-01          EN-----GD----GLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD
B5XEF1_BAD-01          GG-----GD----GASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLD
A0A3B4CPH6_BAD-01      ESGAVRHGDGAADGDSFRRRCRSAPPALWAAKKYGRQLRKMSDEFDTLLD
H3D8J8_BAD-01          AG---TPTD----GAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3B5L9R9_BAD-01      VG---TPTE----GFPFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A3B1IH05_BAD-01      -----GARD----GDSFRRRSRSAPPSLWAAKKYGRQLRKMSDEFDKGLE
A0A3Q2QC80_BAD-01      AG---TPTE----GLPFRNRSNSAPPALWAAKKYGRQLRRMSDEFGSLLD
A0A3Q3MLA0_BAD-02      AG---TPTE----GAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDILLD
A0A3Q3MLA0_BAD-03      AG---TPTE----GAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDILLD
I3K7B6_BAD-01          VC---TPTE----GDPFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD
A0A3P9B2E4_BAD-01      VC---TPTE----GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q3C680_BAD-01      VC---TPTE----GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3P8QRJ7_BAD-01      VC---TPTE----GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q4GGN3_BAD-01      VC---TPTE----GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3B4GXJ6_BAD-01      VC---TPTE----GDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q2D5S0_BAD-01      VG---TPTE----GYPFRGRSNSAPPALWAAKKYGRQLRRMSDEFVTLLD
A0A3B3BQF7_BAD-01      AG---TPTD----GLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q1K1C7_BAD-02      AG---TPTD----GAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q1K1C7_BAD-01      AG---TPTD----GAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q1GWH9_BAD-01      AG---TPTE----GAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q1CPU7_BAD-01      AG---TPTD----GAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3P8TWH6_BAD-01      AG---TPTD----GAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A2U9BAC9_BAD-01      AG---TPTD----GAPFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLD
A0A3B4VFC5_BAD-01      AG---TPTE----GAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD
A0A3B4W9T1_BAD-01      AG---TPTE----GAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD
A0A3Q0QNQ2_BAD-01      IC---TPTE----GDPFRRRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3P8WIZ8_BAD-02      AG---TPTE----GAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3P8WIZ8_BAD-01      AG---TPTE----GAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3P9A5G8_BAD-02      SG-----GD----AAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLD
A0A3P9A5G8_BAD-01      SG-----GD----AAPFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLD
B5X1T1_BAD-01          GG-----GD----GAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLD
H3ANP3_BAD-03          SESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS
H3ANP3_BAD-04          SESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS
H3ANP3_BAD-02          SESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS
H3ANP3_BAD-01          SESQISDSESLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS
A0A3B3QX41_BAD-01      EGGGVCPGD----GTPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDTLLD
Q4V925_BAD-02          TG---VAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D
Q4V925_BAD-03          TG---VAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D
A7MCM4_BAD-01          TG---VAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D
Q4V925_BAD-04          TG---VAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D
Q4V925_BAD-01          TG---VAEDPHMLGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D
A0A3P8Y761_BAD-01      NC---VATE----GLPFRVRSQSAPPALWAAKRYGRQLRRMSDEFDTWLD
A0A3B5K831_BAD-01      AG---TPTE----GAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLD
A0A3B5Q2N7_BAD-01      VG---TPTE----GFPFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A087X8P8_BAD-01      VG---TPTE----GFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A3B3UA11_BAD-01      VG---TPTE----GFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A3B3YFR1_BAD-01      VG---TPTE----GFPFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A3P9Q7C3_BAD-01      VG---TPTE----GFPFRVRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD
A0A3B3HDU2_BAD-01      AG---TPTD----GLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3B5BAL2_BAD-01      AG---TPTD----GAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD
A0A3Q3AEL8_BAD-02      PG---TPTE----GYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q3AEL8_BAD-01      PG---TPTE----GYPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
G3Q8B3_BAD-01          TG---TPTE----GAPFRVRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q2Y0E4_BAD-01      VG---TPTD----GAPFRGRSKSAPPVLWAAKKYGRQLRRMSDEFDSLMD
A0A3Q3R5S3_BAD-01      AG---TPTD----GAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD
A0A3Q3RXS8_BAD-02      AG---TPTD----GAPFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q3RXS8_BAD-01      AG---TPTD----GAPFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q0QNQ2_BAD-02      IC---TPTE----GDPFRRRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD
A0A3Q3WTY4_BAD-01      AG---TPTD----GAPFRGRSKSAPPSLWAAKKYGQRLRRMSDEF----D
A0A3Q3MLA0_BAD-01      ARGEEEAGTPTEG-APFRGRSKSAPPALWAAKKYGRQLRRMSDEFDILLD
G1SS60_BAD-01          ADADDSEGAEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSVK
A0A3B4DUY7_BAD-01      DGLLAEDGGAGDG-APFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD
A0A337SAW2_BAD-01      AGTEEDEGTEEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSF-
A0A2I3TBK7_BAD-01      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-
A0A2R8Z697_BAD-02      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-
A0A2I2Z8C7_BAD-03      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAAHP-
Q92934_BAD-03          AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPHP-
A0A2K5M0C1_BAD-02      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-
A0A2K5XJR2_BAD-02      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-
A0A2I3MCN5_BAD-03      AAKLQLDASLPVLVGSELGQG---------------KLRPLPVTFAPRP-
A0A2K5VCD8_BAD-02      AAKLQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-
F7GVS7_BAD-02          AAKLQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-
A0A2K6E7J3_BAD-02      AAKLQLDASLPVLVGSELGQG---------------KLRTLPVTFAPRP-
A0A2K5E6K7_BAD-02      AAKLQLDASHPVLVGSELGQG---------------RLRSLPVTFAPHP-
A0A2K6TG62_BAD-02      AAKLQLDASHPVLVGSELGQG---------------RLRSLPVTFAPHP-
A0A2K5E6K7_BAD-03      SARMLSKASAGMSAPATDS-----E---------NVKLE-VPC-W---V-
A0A2K5HKW9_BAD-02      SARMLTEASAGMSAPATDSEAQHAE---------NVKLEALGL-WRPGV-
A0A2K6N1A1_BAD-02      SARMLAEASAGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV-
A0A2K6PUM5_BAD-02      SARMLAEASAGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV-
A0A2K5M0C1_BAD-03      SARMLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-
A0A2K5VCD8_BAD-03      SARMLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-
F7GVS7_BAD-03          SARMLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV-
A0A2K5XJR2_BAD-03      SARMLAEASARMSAPATDSEAQLAE---------NVKLKALGL-WRPGV-
A0A2I3MCN5_BAD-02      SARMLAEASAPMSAPATDSEAQHAE---------NVKLKALGL-WRRGV-
A0A2K6E7J3_BAD-03      SARMLAEASARMSAPATDSEAQHAE---------NVKLKALGL-WRPAV-
A0A2I2Z8C7_BAD-04      SAGMLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-
Q92934_BAD-04          SAGMLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-
A0A2I3TBK7_BAD-03      SAGMLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-
A0A2R8Z697_BAD-03      SAGMLAEASAGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV-
F6SJL0_BAD-02          SVRMFSKASAGMSAPATDSEAQHTE---------NVKLEALGL-WRPGV-
A0A2K6TG62_BAD-03      SAKMLSKASAGMSAPATDSEAQHTE---------NVKLEALEP-WRHGV-
G3VRY4_BAD-02          AEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-
G3VRY4_BAD-01          AEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF-
G1P8C5_BAD-01          TGTEEDDDTEEGEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFK
A0A452ER54_BAD-02      AGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-
W5P8G9_BAD-01          AGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-
G3TP47_BAD-01          AGSDEAEGLEEDP-SPFRGRSLSAPPNLWAAQRYGRELRRMSDEFQGYF-
G1MI17_BAD-01          AGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSF-
A0A287AEF3_BAD-01      EGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEFQGSF-
M3YNE7_BAD-01          AGTEEDEGMEEEELSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSF-
A0A452RJM6_BAD-01      AGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSF-
A0A384DJL2_BAD-01      AGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSF-
A0A452ER54_BAD-01      AGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-
F1MUT9_BAD-01          AGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-
Q3SYZ0_BAD-01          AGPEDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF-
F7DN67_BAD-01          EGTEDEGMEGEEP-GPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSF-
O35147_BAD-01          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
H0WVR2_BAD-01          AGTEEDEGI-EEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFK
H0V608_BAD-01          AGTEEEEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K5E6K7_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K6TG62_BAD-01      AGTEGDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A0D9R491_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K5M0C1_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K5VCD8_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
F7GVS7_BAD-01          AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K6E7J3_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K5XJR2_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2I3MCN5_BAD-04      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K6N1A1_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K6PUM5_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
A0A2K5HKW9_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF-
B4DZQ9_BAD-01          AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2K6GWV0_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFK
F6SJL0_BAD-01          AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2I3MCN5_BAD-01      AGTEEDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2I2Z8C7_BAD-02      AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2I2Z8C7_BAD-01      AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
Q92934_BAD-01          AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
Q92934_BAD-02          AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2I3TBK7_BAD-02      AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2R8Z697_BAD-01      AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
A0A2J8TYJ3_BAD-01      AGTEDDEGMGEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK
F1PK10_BAD-01          AGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF-
Q45KI9_BAD-01          AGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF-
I3MBM5_BAD-01          ADTDLDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
I3MBM5_BAD-02          ADTDLDEGMEEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-05          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-04          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-03          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-06          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-02          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
Q61337_BAD-01          AGTEEDEGMEEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF-
                                                            :            

F7GVS7_BAD-04          VSAGPPPRPPRAG---------------LS------------LPCPKARP
Q2PG01_BAD-01          ----GLPRPKSAG---------------TA------------TQMRQSSS
A0A2I3H4B2_BAD-01      ----GLPRPKSAG---------------TA------------TQMRQSSS
Q6P7C5_BAD-01          --------QPGQA---------------AN------------NSHHGGRF
A0A287AEF3_BAD-02      --EALGLWRPGVA---------------TA------------LTQRGPRR
A0A3B1JLM2_BAD-01      --KGDLRRTTGPG-------------------------------RHTNRG
A0A452IFQ4_BAD-01      --V--LPRPKSAG---------------TT------------SQLHRGNS
C1C3S9_BAD-01          --S--IPRPKSAS---------------AA------------TEMTVSKS
F6Z067_BAD-01          --G--LPRPKSAS---------------AA------------GQMTGNRS
E7FBJ6_BAD-01          --KGVSK----T----------------PN------------SQKQTYRG
B5XEF1_BAD-01          --KGVPKRGIIP----------------RG------------GKQKVSRG
A0A3B4CPH6_BAD-01      --KG-MKRVRSAG---------------AA------------RQMHASPS
H3D8J8_BAD-01          --KGGMRKTSSAG---------------SA------------RQMHHSRS
A0A3B5L9R9_BAD-01      --KGEMRNVSSDG---------------SN------------RPIHHSRS
A0A3B1IH05_BAD-01      --QG-MKRVRSAG---------------AA------------RQMQNSPS
A0A3Q2QC80_BAD-01      --KGELRKVSSAG---------------TN------------RPIHHSRS
A0A3Q3MLA0_BAD-02      --KGVRIKGGGGGSRGGCGLVVESVVSQPK------------SQEFNTQL
A0A3Q3MLA0_BAD-03      --KGEMKKVRSPG---------------PA------------KQMHHSKS
I3K7B6_BAD-01          --KGEMK----------------------L------------KKLHHSKT
A0A3P9B2E4_BAD-01      --KG----------------------------------------------
A0A3Q3C680_BAD-01      --KGEMK----------------------V------------KKLHHSKT
A0A3P8QRJ7_BAD-01      --KGEMK----------------------V------------KKLHHSKT
A0A3Q4GGN3_BAD-01      --KGEMK----------------------L------------KKLHHSKT
A0A3B4GXJ6_BAD-01      --KGEMK----------------------V------------KKLHHSKT
A0A3Q2D5S0_BAD-01      --KGELRKVSSTG---------------TN------------RPIRHSKS
A0A3B3BQF7_BAD-01      --KGEMRKVRSAG---------------AT------------KQMHHSTS
A0A3Q1K1C7_BAD-02      --KGEMRKVRSAG---------------TA------------RQMHHSKS
A0A3Q1K1C7_BAD-01      --KGEMRKVRSAG---------------TA------------RQMHHSKS
A0A3Q1GWH9_BAD-01      --KGEMKRVRSAG---------------TA------------RQMHHSKS
A0A3Q1CPU7_BAD-01      --KGEMKRVRSAG---------------TA------------RQMHHSKS
A0A3P8TWH6_BAD-01      --KGEMKRVRSAG---------------TA------------RQMHHSKS
A0A2U9BAC9_BAD-01      --KGEMRKVKSAG---------------TA------------RQMHHSQS
A0A3B4VFC5_BAD-01      --KGEMRKVKSAG---------------TA------------KQMHHSKS
A0A3B4W9T1_BAD-01      --KGEMRKVKSAG---------------TA------------KQMHHSKS
A0A3Q0QNQ2_BAD-01      --KG-MKKAKNAG---------------TT------------RKMHHSKT
A0A3P8WIZ8_BAD-02      --KG-MRKVKSAG---------------TA------------RQMHHSKS
A0A3P8WIZ8_BAD-01      --KG-MRKVKSAG---------------TA------------RQMHHSKS
A0A3P9A5G8_BAD-02      --KGEPKRGIIPG---------------RA------------KQ-VY-RG
A0A3P9A5G8_BAD-01      --KGEPKRGIIPG---------------RA------------KQ-VY-RG
B5X1T1_BAD-01          --KGEPKRGISPG---------------GV------------KQEVS-RG
H3ANP3_BAD-03          --FLGLPRPKSAG---------------AA------------GEMVD-ES
H3ANP3_BAD-04          --FLGLPRPKSAG---------------AA------------GEMVD-ES
H3ANP3_BAD-02          --FLGLPRPKSAG---------------AA------------GEMVD-ES
H3ANP3_BAD-01          --FLGLPRPKSAG---------------AA------------GEMVD-ES
A0A3B3QX41_BAD-01      --KG-MKRVRSAG---------------AA------------RQMQASPS
Q4V925_BAD-02          --KG-MKRVKSAG---------------TA------------RQMSQSPS
Q4V925_BAD-03          --KG-MKRVKSAG---------------TA------------RQMSQSPS
A7MCM4_BAD-01          --KGQMKRVKSAG---------------TA------------RQMSQSPS
Q4V925_BAD-04          --KGQMKRVKSAG---------------TA------------RQMSQSPS
Q4V925_BAD-01          --KGQMKRVKSAG---------------TA------------RQMSQSPS
A0A3P8Y761_BAD-01      --KGQMKRVKSAG---------------AA------------KQMTTSPS
A0A3B5K831_BAD-01      --KGGMRKTNSTG---------------ST------------KPMHHSRS
A0A3B5Q2N7_BAD-01      --KGEMRNVSSDG---------------SN------------RPIHHSRS
A0A087X8P8_BAD-01      --KGEMRKVSSTG---------------SN------------RPIHHSRS
A0A3B3UA11_BAD-01      --KGEMRKVSSTG---------------SN------------RPIHHSRS
A0A3B3YFR1_BAD-01      --KGEMRKVSSTG---------------SN------------RPIHHSRS
A0A3P9Q7C3_BAD-01      --KGEMRKVSSAG---------------SN------------GPIHHSRS
A0A3B3HDU2_BAD-01      --KGEMRKVRSTG---------------AA------------KQMLHSTS
A0A3B5BAL2_BAD-01      --KGEMKRVRSAG---------------TA------------KQMHHSKS
A0A3Q3AEL8_BAD-02      --KGEMRKVKSAG---------------TT------------KQIHHSRS
A0A3Q3AEL8_BAD-01      --KGEMRKVKSAG---------------TT------------KQIHHSRS
G3Q8B3_BAD-01          --KGEMRRVKSAG---------------TT------------KQMQHSKS
A0A3Q2Y0E4_BAD-01      --KGELKFKSAGG---------------TS------------RAIHHSKT
A0A3Q3R5S3_BAD-01      --KGEMKRVRSAG---------------AA------------SQMHHSKS
A0A3Q3RXS8_BAD-02      --KGEMR-VRNAG---------------KA------------QKMHHSKT
A0A3Q3RXS8_BAD-01      --KGEMR-VRNAG---------------KA------------QKMHHSKT
A0A3Q0QNQ2_BAD-02      --KGMKK-AKNAG---------------TT------------RKMHHSKT
A0A3Q3WTY4_BAD-01      --RQEWK-TRSAG---------------TA------------TQMHQSRS
A0A3Q3MLA0_BAD-01      --KG-VRIKGGGG---------------GSRGGCGLVVESVVSQPKSQEF
G1SS60_BAD-01          --KG-LPRPKSAG---------------TA------------MQMRESSS
A0A3B4DUY7_BAD-01      --KG-DTR-------------------------------------RASSP
A0A337SAW2_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSPS
A0A2I3TBK7_BAD-01      --ET-PPVPTALG---------------SH------------LEYGRKYF
A0A2R8Z697_BAD-02      --ET-PPVPTALG---------------SH------------LEYGRKYF
A0A2I2Z8C7_BAD-03      --ET-PPVPTALG---------------SH------------LEYGRKYF
Q92934_BAD-03          --ET-PPVPTALG---------------SH------------LEYGRKYF
A0A2K5M0C1_BAD-02      --ET-PPALTVLV---------------GH------------LGYGRKCF
A0A2K5XJR2_BAD-02      --ET-PPALTVLV---------------GH------------LGYGRKCF
A0A2I3MCN5_BAD-03      --ET-PPALTVLV---------------GH------------LGYGRKCF
A0A2K5VCD8_BAD-02      --ET-PPALTVLV---------------GH------------LGYGRKCF
F7GVS7_BAD-02          --ET-PPALTVLV---------------GH------------LGYGRKCF
A0A2K6E7J3_BAD-02      --ET-PPALTVLV---------------GH------------LGYGRKCF
A0A2K5E6K7_BAD-02      --ET-PPVPIALG---------------GH------------LGYGRKCF
A0A2K6TG62_BAD-02      --ET-LPAPIALG---------------GH------------LGHGRKCF
A0A2K5E6K7_BAD-03      --AT-APTPQGRR---------------RT------------KGWRRSPA
A0A2K5HKW9_BAD-02      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K6N1A1_BAD-02      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K6PUM5_BAD-02      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K5M0C1_BAD-03      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K5VCD8_BAD-03      --AT-APTPRGRR---------------RT------------KGWRRSPA
F7GVS7_BAD-03          --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K5XJR2_BAD-03      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2I3MCN5_BAD-02      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2K6E7J3_BAD-03      --AT-APTPRGRR---------------RT------------KGWRRSPA
A0A2I2Z8C7_BAD-04      --AT-APTPRGRR---------------TT------------KGWGRSPA
Q92934_BAD-04          --AT-APTPRGRR---------------TT------------KGWGRSPA
A0A2I3TBK7_BAD-03      --AT-APTPRGRR---------------TT------------KGWGRSPA
A0A2R8Z697_BAD-03      --AT-APTPRGRR---------------TT------------KGWGRSPA
F6SJL0_BAD-02          --AT-ARTPQGRR---------------RT------------KGWRRSPA
A0A2K6TG62_BAD-03      --AT-ARTPQGRR---------------GT------------KGWRRSPA
G3VRY4_BAD-02          --KG-LPRPKSAG---------------TA------------SQMRRSHG
G3VRY4_BAD-01          --KG-LPRPKSAG---------------TA------------SQMRRSHG
G1P8C5_BAD-01          --KG-LPRPKSAG---------------TA------------TQMWQKSS
A0A452ER54_BAD-02      --KG-LPRPKSAG---------------TA------------TQMRQSPS
W5P8G9_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
G3TP47_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
G1MI17_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
A0A287AEF3_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSPS
M3YNE7_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
A0A452RJM6_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSPS
A0A384DJL2_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSPS
A0A452ER54_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSPS
F1MUT9_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
Q3SYZ0_BAD-01          --KG-LPRPKSAG---------------TA------------TEMRQSPS
F7DN67_BAD-01          --QA-LPRPKSAG---------------TA------------TQMRQSPS
O35147_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSAS
H0WVR2_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSSS
H0V608_BAD-01          --KG-LPRPKSAG---------------TA------------TKLWQNSN
A0A2K5E6K7_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K6TG62_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A0D9R491_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K5M0C1_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K5VCD8_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
F7GVS7_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K6E7J3_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K5XJR2_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2I3MCN5_BAD-04      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K6N1A1_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K6PUM5_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2K5HKW9_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
B4DZQ9_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPR
A0A2K6GWV0_BAD-01      --KG-LPRPKSAG---------------TA------------TQIRQSSS
F6SJL0_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2I3MCN5_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2I2Z8C7_BAD-02      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2I2Z8C7_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
Q92934_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSSS
Q92934_BAD-02          --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2I3TBK7_BAD-02      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2R8Z697_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
A0A2J8TYJ3_BAD-01      --KG-LPRPKSAG---------------TA------------TQMRQSSS
F1PK10_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
Q45KI9_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSPS
I3MBM5_BAD-01          --KG-LPRPRSAG---------------TA------------SQMRQSSS
I3MBM5_BAD-02          --K-----------------------------------------------
Q61337_BAD-05          --KV-SASVRCDG---------------T---------------------
Q61337_BAD-04          --KG-LPRPKSAG---------------TA------------TQMRQSAG
Q61337_BAD-03          --KG-LPRPKSAG---------------TA------------TQMRQSAG
Q61337_BAD-06          --KG-LPRPKSAG---------------TA------------TQMRQSAG
Q61337_BAD-02          --KG--------------------------------------EELTYSLS
Q61337_BAD-01          --KG-LPRPKSAG---------------TA------------TQMRQSAG
                                                                         

F7GVS7_BAD-04          --------------------------DLM-SHDPSPTPSCPFLAP-----
Q2PG01_BAD-01          W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2I3H4B2_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
Q6P7C5_BAD-01          L---------------TSIIFLSHVP------------------------
A0A287AEF3_BAD-02      M---------------KGLRMRSSAPSAADRSRRPPSSGLHSVMAASSGG
A0A3B1JLM2_BAD-01      W---------------FSFLWGTKEEEGRE--------------------
A0A452IFQ4_BAD-01      W---------------KETLQAWLGHRPARDALPRSSK------------
C1C3S9_BAD-01          F---------------GETFFNFFRRKNKDRSQSENDKH-----------
F6Z067_BAD-01          I---------------RDLIMGLFSRRKSKGRDESGDEE-----------
E7FBJ6_BAD-01          W---------------FSFLWSPKEEEGR--------------E------
B5XEF1_BAD-01          W---------------FSFLWSPKEAEGR--------------E------
A0A3B4CPH6_BAD-01      W---------------FTFLWSHKESDSE-ASSSLTAPDTRPAE------
H3D8J8_BAD-01          W---------------WSYLFSHQETESE---NNHHD-------------
A0A3B5L9R9_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A3B1IH05_BAD-01      W---------------FAFLWSHKESDSE-------ASSSRPAE------
A0A3Q2QC80_BAD-01      W---------------WNYLFSHQETEGE---NSHHENHAPRTE------
A0A3Q3MLA0_BAD-02      LQPHVRCVLGSLNVYKWDYLILIITLHSS---L-----------------
A0A3Q3MLA0_BAD-03      W---------------WSYLFSHQETEGE---NNHHENHTHRNE------
I3K7B6_BAD-01          W---------------WSYLFSHQETEGE---NNHLE-------------
A0A3P9B2E4_BAD-01      --------------------VRMGVSQGL---N-----------------
A0A3Q3C680_BAD-01      W---------------WSYLFSHQETEGE---NNHLENHNQRTE------
A0A3P8QRJ7_BAD-01      W---------------WSYLFSHQETEGE---NNHLENHNQRTE------
A0A3Q4GGN3_BAD-01      W---------------WSYLFSHQETEGE---NNHLENHNQRTE------
A0A3B4GXJ6_BAD-01      W---------------WSYLFSHQETEGE---NNHLENHNQRTE------
A0A3Q2D5S0_BAD-01      W---------------WSYLFSHQEMEGE---NSHHENHTQCTEQRGE--
A0A3B3BQF7_BAD-01      W---------------WNYLFSHPEAEGE---YSHHESH--RTE------
A0A3Q1K1C7_BAD-02      W---------------WSYLFSHQETEGE---NNHHESHTHRTE------
A0A3Q1K1C7_BAD-01      W---------------WSYLFSHQETEGE---NNHHESHTHRTE------
A0A3Q1GWH9_BAD-01      W---------------WSYLFSHQEMEGE---NNHHESHTHRNE------
A0A3Q1CPU7_BAD-01      W---------------WSYLFSHQEMEGE---NNHHESHTHRNE------
A0A3P8TWH6_BAD-01      W---------------WSYLFSHQEMEGE---NNHHESHTHRNE------
A0A2U9BAC9_BAD-01      W---------------WSYLFSHQEMEGE---NNHHENHTQRNE------
A0A3B4VFC5_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHTHRTE------
A0A3B4W9T1_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHTHRTE------
A0A3Q0QNQ2_BAD-01      W---------------WSYLFSHQESDGE---NSHHENHTQRTE------
A0A3P8WIZ8_BAD-02      W---------------WSYLFSHQELEGE---NNHHENHTHRTE------
A0A3P8WIZ8_BAD-01      W---------------WSYLFSHQELEGE---NNHHENHTHRTE------
A0A3P9A5G8_BAD-02      W---------------FSFLWSPKEAEGR--------------D------
A0A3P9A5G8_BAD-01      W---------------FSFLWSPKEAEGR--------------D------
B5X1T1_BAD-01          W---------------FSFLWSPKKAEGR--------------E------
H3ANP3_BAD-03          W---------------WKKLIRSLKGRGQ-----PRDPPGQ---------
H3ANP3_BAD-04          W---------------WKKLIRSLKGRGQ-----PRDPPGQ---------
H3ANP3_BAD-02          W---------------WKKLIRSLKGRGQ-----PRDPPGQQGVSIRGPD
H3ANP3_BAD-01          W---------------WKKLIRSLKGRGQ-----PRDPPGQQGVSIRGPD
A0A3B3QX41_BAD-01      W---------------FAFLWSHKESDAE-ISGSLSTADSRAAQ------
Q4V925_BAD-02          W---------------LAFLWSHKESDAE----------SRPAE------
Q4V925_BAD-03          W---------------LAFLWSHKESDAE----------SRPAE------
A7MCM4_BAD-01          W---------------LAFLWSHKESDAE----------SRPAE------
Q4V925_BAD-04          W---------------LAFLWSHKESDAE----------SRPAE------
Q4V925_BAD-01          W---------------LAFLWSHKESDAE----------SRPAE------
A0A3P8Y761_BAD-01      W---------------WAFLFSHKETETE-KTPNLIITEPRSSE------
A0A3B5K831_BAD-01      W---------------WSYLFSHQETEGE---NGHHDGHTHRTE------
A0A3B5Q2N7_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A087X8P8_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A3B3UA11_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A3B3YFR1_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A3P9Q7C3_BAD-01      W---------------WSYLFSHQETEGE---NNHHENHASRTE------
A0A3B3HDU2_BAD-01      W---------------WNYLFSHPEAEGE---YSHHE--SHRTE------
A0A3B5BAL2_BAD-01      W---------------WSYLFSHQELEGE---NNHHENHTHRNE------
A0A3Q3AEL8_BAD-02      W---------------WNYLFSHQETDGE---SSHHEKPTHRTE------
A0A3Q3AEL8_BAD-01      W---------------WNYLFSHQETDGE---SSHHEKPTHRTE------
G3Q8B3_BAD-01          W---------------WSSLFSHQEMEGE---NNHHE-------------
A0A3Q2Y0E4_BAD-01      W---------------WSYLFSHQETEGENNNNNHHDNHANRTE------
A0A3Q3R5S3_BAD-01      W---------------WSYLFSHQETEGE---NTHHENAALAQEVERVVS
A0A3Q3RXS8_BAD-02      W---------------WSYLFSYQETDGE---NNLHENHTPRTE------
A0A3Q3RXS8_BAD-01      W---------------WSYLFSYQETDGE---NNLHENHTPRTE------
A0A3Q0QNQ2_BAD-02      W---------------WSYLFSHQESDGE---NSHHENHTQRTE------
A0A3Q3WTY4_BAD-01      W---------------WSYLFSHQETDGE---NNHHDSHTHRNE------
A0A3Q3MLA0_BAD-01      N---------------TQLLQPHVRCVLG-SLNVYKWDYLILIITLHSSL
G1SS60_BAD-01          W---------------TRVIQSWWDRNLG-KGGSAPSQ------------
A0A3B4DUY7_BAD-01      G---------------KQTNRGWFSFLWG-SKEEEGRE------------
A0A337SAW2_BAD-01      W---------------TRFIQSWWDRNLG-RGGSAPSQ------------
A0A2I3TBK7_BAD-01      P---------------QAYAK---------RGSVLSPLEGGLTPIPFRCV
A0A2R8Z697_BAD-02      P---------------QAYAK---------RGSVLSPLEGGLTQIPFRCV
A0A2I2Z8C7_BAD-03      P---------------QAYAK---------RGSVLSPLEGRLTQIPFRCV
Q92934_BAD-03          P---------------QAYAK---------RGSVLSPLEGGLTQIPFRCV
A0A2K5M0C1_BAD-02      P---------------QALCK---------RGSVLPLSVGGLTQIPFRCM
A0A2K5XJR2_BAD-02      P---------------QASCK---------RGSVLPLSVGGLTQIPFRCM
A0A2I3MCN5_BAD-03      P---------------QALCK---------RGSVLPLSVGGLTQIPFRCM
A0A2K5VCD8_BAD-02      P---------------QALCK---------RGSVLPLSVGGLTQIPFRCM
F7GVS7_BAD-02          P---------------QALCK---------RGSVLPLSVGGLTQIPFRCM
A0A2K6E7J3_BAD-02      P---------------QALCK---------RGSVLPLSVGGLTQIPFRCM
A0A2K5E6K7_BAD-02      L---------------Q----------------------GELTQIPFRCV
A0A2K6TG62_BAD-02      L---------------Q----------------------GGLTQIPFRCV
A0A2K5E6K7_BAD-03      P---------------FGAVRAQHPPTSG-QHSAMAASSGG---------
A0A2K5HKW9_BAD-02      P---------------FGAARAPRPLTSG-QHSDMAASSGG---------
A0A2K6N1A1_BAD-02      P---------------FGAARAPRPLTSG-QHSDMAASSGG---------
A0A2K6PUM5_BAD-02      P---------------FGAARAPRPLTSG-QHSDMAASSGG---------
A0A2K5M0C1_BAD-03      P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
A0A2K5VCD8_BAD-03      P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
F7GVS7_BAD-03          P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
A0A2K5XJR2_BAD-03      P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
A0A2I3MCN5_BAD-02      P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
A0A2K6E7J3_BAD-03      P---------------FGAARAPRPPTSG-QHSVMAASSGG---------
A0A2I2Z8C7_BAD-04      P---------------FGAARARRPPTSG-QHSAMAASSGG---------
Q92934_BAD-04          P---------------FGAARARRPPTSG-QHSAMAASSGG---------
A0A2I3TBK7_BAD-03      P---------------FGAARARRPPTSG-QHSAMAASSGG---------
A0A2R8Z697_BAD-03      P---------------FGAARARRPPTSG-QHSAMAASSGG---------
F6SJL0_BAD-02          P---------------FGAVRARHPPTSG-QHSAMAASSGG---------
A0A2K6TG62_BAD-03      L---------------FGAVRARHPPTSG-QHSDMAASSGG---------
G3VRY4_BAD-02          W---------------TRTFQSWFGRNLG-KGSVGPSH------------
G3VRY4_BAD-01          W---------------TRTFQSWFGRNLG-KGSVGPSH------------
G1P8C5_BAD-01          W---------------TRFFQSWWDRNSG-RGGSAPSQ------------
A0A452ER54_BAD-02      W---------------TRFLQSWLSRNLG-RGGSAPSQ------------
W5P8G9_BAD-01          W---------------TRFLQSWLSRNLG-RGGSAPSQ------------
G3TP47_BAD-01          W---------------TRIIQAWWDRNLG-RGSSAPSQ------------
G1MI17_BAD-01          W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A287AEF3_BAD-01      W---------------KRFLQSWWYRNSG-RGGPAPSQ------------
M3YNE7_BAD-01          W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A452RJM6_BAD-01      W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A384DJL2_BAD-01      W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A452ER54_BAD-01      W---------------TRFLQSWLSRNLG-RGGSAPSQ------------
F1MUT9_BAD-01          W---------------TRFLQSWLSRNLG-RGGSAPSQ------------
Q3SYZ0_BAD-01          W---------------TRFLQSWLSRNLG-RGGSAPSQ------------
F7DN67_BAD-01          W---------------TRAIQSWWDRNLG-RGGSAPSQ------------
O35147_BAD-01          W---------------TRIIQSWWDRNLG-KGGSTPSQ------------
H0WVR2_BAD-01          W---------------TRVIQSWWDRNVG-RGGSAPCQ------------
H0V608_BAD-01          W---------------TRAIQSWWDRNLG-RGGSAPSQESV---------
A0A2K5E6K7_BAD-01      W---------------TQVIQSWWDRNLG-RGGSAPSQ------------
A0A2K6TG62_BAD-01      W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A0D9R491_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K5M0C1_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K5VCD8_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
F7GVS7_BAD-01          W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K6E7J3_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K5XJR2_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2I3MCN5_BAD-04      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K6N1A1_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K6PUM5_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2K5HKW9_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
B4DZQ9_BAD-01          R---------------LR--------------------------------
A0A2K6GWV0_BAD-01      W---------------TRVIQSWWDRNVG-RGGSAPSQ------------
F6SJL0_BAD-01          W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
A0A2I3MCN5_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2I2Z8C7_BAD-02      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2I2Z8C7_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
Q92934_BAD-01          W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
Q92934_BAD-02          W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2I3TBK7_BAD-02      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2R8Z697_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
A0A2J8TYJ3_BAD-01      W---------------TRVFQSWWDRNLG-RGSSAPSQ------------
F1PK10_BAD-01          W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
Q45KI9_BAD-01          W---------------TRVIQSWWDRNLG-RGGSAPSQ------------
I3MBM5_BAD-01          W---------------TRFIQSWWDRNLG-RRGSAPSQ------------
I3MBM5_BAD-02          ----------------VTFSQSPFLRA-----------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          W---------------TRIIQSWWDRNLG-KGGSTPSQ------------
Q61337_BAD-03          W---------------TRIIQSWWDRNLG-KGGSTPSQ------------
Q61337_BAD-06          W---------------TRIIQSWWDRNLG-KGGSTPSQ------------
Q61337_BAD-02          P---------------FRCVQ-----------------------------
Q61337_BAD-01          W---------------TRIIQSWWDRNLG-KGGSTPSQ------------
                                                                         

© 1998-2019