Dataset for protein Bad of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

117 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          --------------------------------------------------
F6Z067_BAD-01          --------------------------------------------------
A0A3B1JLM2_BAD-01      --------------------------------------------------
A0A3B4CPH6_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------------------------------
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3B3QX41_BAD-01      --------------------------------------------------
A0A1W4YVX7_BAD-01      --------------------------------------------------
A0A1W4YVX7_BAD-02      --------------------------------------------------
A0A3B5K831_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A2D0SYM2_BAD-01      --------------------------------------------------
A0A3B4DUY7_BAD-01      --------------------------------------------------
G1SS60_BAD-01          --------------------------------------------------
A0A337SAW2_BAD-01      MGTPENPLSAPTHVPGPGMSGTEQREARKGPRTKAVGREQVPRRGRRLGR
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------------
G3VRY4_BAD-02          --------------------------------------------------
G3VRY4_BAD-01          --------------------------------------------------
I3MBM5_BAD-02          --------------------------------------------------
I3MBM5_BAD-01          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
G3TP47_BAD-01          --------------------------------------------------
F7DN67_BAD-01          --------------------------------------------------
G1MI17_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-01      --------------------------------------------------
O35147_BAD-01          --------------------------------------------------
M3YNE7_BAD-01          --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          --------------------------------------------------
Q45KI9_BAD-01          --------------------------------------------------
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          -----------------------------------------------MGD
F6Z067_BAD-01          -----------------------------------------------MAD
A0A3B1JLM2_BAD-01      ----MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWN
A0A3B4CPH6_BAD-01      --------------------------------------------------
E7FBJ6_BAD-01          --------------------------------------------------
B5XEF1_BAD-01          --------------------------------------------------
I3K7B6_BAD-01          --------------------------------------------------
A0A3B4GXJ6_BAD-01      --------------------------------------------------
B5X1T1_BAD-01          --------------------------------------------------
H3ANP3_BAD-03          --------------------------------------------------
H3ANP3_BAD-01          --------------------------------------------------
H3ANP3_BAD-02          --------------------------------------------------
H3ANP3_BAD-04          --------------------------------------------------
H3D8J8_BAD-01          --------------------------------------------------
A0A3B5L9R9_BAD-01      --------------------------------------------------
A0A3B1IH05_BAD-01      --------------------------MSTAARAAAGTCDSTAVSQPSKLD
Q4V925_BAD-02          --------------------------------------------------
Q4V925_BAD-03          --------------------------------------------------
A7MCM4_BAD-01          --------------------------------------------------
Q4V925_BAD-04          --------------------------------------------------
Q4V925_BAD-01          --------------------------------------------------
A0A3B3BQF7_BAD-01      --------------------------------------------------
A0A2U9BAC9_BAD-01      --------------------------------------------------
A0A3B4VFC5_BAD-01      --------------------------------------------------
A0A3B4W9T1_BAD-01      --------------------------------------------------
A0A3B3QX41_BAD-01      -----------------------------------------------MSG
A0A1W4YVX7_BAD-01      --------------------------------------------------
A0A1W4YVX7_BAD-02      ------------------------------MSKKTRNKALEGGVRKDAAD
A0A3B5K831_BAD-01      --------------------------------------------------
A0A087X8P8_BAD-01      --------------------------------------------------
A0A3B3UA11_BAD-01      --------------------------------------------------
A0A3B3YFR1_BAD-01      --------------------------------------------------
A0A3B5Q2N7_BAD-01      --------------------------------------------------
A0A3B3HDU2_BAD-01      --------------------------------------------------
G3Q8B3_BAD-01          --------------------------------------------------
A0A3B5BAL2_BAD-01      --------------------------------------------------
A0A2D0SYM2_BAD-01      ------------------------------------------------MS
A0A3B4DUY7_BAD-01      ------------------------------------------------MS
G1SS60_BAD-01          --------------------------------------------------
A0A337SAW2_BAD-01      KRPRPLASPGDISKADWAGSVTVPVAQATRAGLPQYWREAAGPGQGPRDR
A0A2I3TBK7_BAD-01      --------------------------------------------------
A0A2R8Z697_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-03      --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
A0A2K5M0C1_BAD-02      --------------------------------------------------
A0A2K5XJR2_BAD-02      --------------------------------------------------
A0A2I3MCN5_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-02      --------------------------------------------------
F7GVS7_BAD-02          --------------------------------------------------
A0A2K6E7J3_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-02      --------------------------------------------------
A0A2K6TG62_BAD-02      --------------------------------------------------
A0A2K5E6K7_BAD-03      --------------------------------------------------
A0A2K5HKW9_BAD-02      --------------------------------------------------
A0A2K6N1A1_BAD-02      --------------------------------------------------
A0A2K6PUM5_BAD-02      --------------------------------------------------
A0A2K5M0C1_BAD-03      --------------------------------------------------
A0A2K5VCD8_BAD-03      --------------------------------------------------
F7GVS7_BAD-03          --------------------------------------------------
A0A2K5XJR2_BAD-03      --------------------------------------------------
A0A2I3MCN5_BAD-02      --------------------------------------------------
A0A2K6E7J3_BAD-03      --------------------------------------------------
A0A2I2Z8C7_BAD-04      --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
A0A2I3TBK7_BAD-03      --------------------------------------------------
A0A2R8Z697_BAD-03      --------------------------------------------------
F6SJL0_BAD-02          --------------------------------------------------
A0A2K6TG62_BAD-03      --------------------------------------------------
G1P8C5_BAD-01          --------------------------------------------------
W5P8G9_BAD-01          --------------------------------------------QGPRYR
G3VRY4_BAD-02          --------------------------------------------------
G3VRY4_BAD-01          --------------------------------------------------
I3MBM5_BAD-02          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
I3MBM5_BAD-01          ---------MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHP
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-01          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
Q61337_BAD-02          ---------MGTPKQPSLAPAHALGLRKS---DPGIRSLGSDAGGRRWRP
G3TP47_BAD-01          ----------------GPPENPSPASTHAQGVRMSGAEHPEKKKGRRRSS
F7DN67_BAD-01          ---------MGTPENPSPAPTHAQGTRKSTAEHPETRRGPRKEGGGRRAG
G1MI17_BAD-01          -------------VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALA
A0A287AEF3_BAD-01      -----------MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSG
O35147_BAD-01          -------------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWR
M3YNE7_BAD-01          --------------------------------------------------
F1MUT9_BAD-01          --------------------------------------------------
Q3SYZ0_BAD-01          --------------------------------------------------
H0WVR2_BAD-01          --------------------------------------------------
H0V608_BAD-01          --------------------------------------------------
A0A2K5E6K7_BAD-01      --------------------------------------------------
A0A2K6TG62_BAD-01      --------------------------------------------------
A0A0D9R491_BAD-01      --------------------------------------------------
A0A2K5M0C1_BAD-01      --------------------------------------------------
A0A2K5VCD8_BAD-01      --------------------------------------------------
F7GVS7_BAD-01          --------------------------------------------------
A0A2K6E7J3_BAD-01      --------------------------------------------------
A0A2K5XJR2_BAD-01      --------------------------------------------------
A0A2I3MCN5_BAD-04      --------------------------------------------------
A0A2K6N1A1_BAD-01      --------------------------------------------------
A0A2K6PUM5_BAD-01      --------------------------------------------------
A0A2K5HKW9_BAD-01      --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
A0A2K6GWV0_BAD-01      --------------------------------------------------
F6SJL0_BAD-01          --------------------------------------------------
A0A2I3MCN5_BAD-01      --------------------------------------------------
A0A2I2Z8C7_BAD-02      --------------------------------------------------
A0A2I2Z8C7_BAD-01      --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
A0A2I3TBK7_BAD-02      --------------------------------------------------
A0A2R8Z697_BAD-01      --------------------------------------------------
A0A2J8TYJ3_BAD-01      --------------------------------------------------
F1PK10_BAD-01          ---------------TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLA
Q45KI9_BAD-01          --------------------------------------------------
                                                                         

F7GVS7_BAD-04          ----------MEEEPS----------------------------------
Q2PG01_BAD-01          ----------MEEEPS----------------------------------
A0A2I3H4B2_BAD-01      ----------MGEEPS----------------------------------
Q6P7C5_BAD-01          PAAQSMFQI-PEFEPSEQEDASTTDRGLGPSLTEDQP------------G
A0A287AEF3_BAD-02      -----MFQI-PEFEQSEQEDSSPADRGLGPSPTGTDP------------Q
C1C3S9_BAD-01          SPHKSMFSI-EEFPPTERGSAFSGTNPPGFGG--DPG-------------
F6Z067_BAD-01          SSPSAVFKL-EEFDNEEQGLPLPFVDPPRGAGVRQPV-------------
A0A3B1JLM2_BAD-01      SSGSTVFTM-EKTPPHSKED------DISPIDDHDESRWSEAVKSVDSPQ
A0A3B4CPH6_BAD-01      --MAHMFTL--SDDSDTSEDLGDADQPEASKRA-----------------
E7FBJ6_BAD-01          -MENTSHDHQDDS------STLDEKERSHLKGT-----------IKNHGQ
B5XEF1_BAD-01          --MDYTHDCVDECESDHSGTTRNSEFQLHVSTT-----------MSNRPR
I3K7B6_BAD-01          --MAANFTI-SDSESETSEEVGEEENQQPAGQD-----------QESKPQ
A0A3B4GXJ6_BAD-01      --MAANFKI-SDSDSEASEEVGEGENQQSAGQA-----------QESKPQ
B5X1T1_BAD-01          --MDHTHDC-VDDNPETMNEHDESDHSGTTHYP-----------EFQRHY
H3ANP3_BAD-03          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKH
H3ANP3_BAD-01          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKH
H3ANP3_BAD-02          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKH
H3ANP3_BAD-04          -----MFQI-SDSDSDAYEDDRTGPLPLQSGGGRGEGSEPSEKTAGLKKH
H3D8J8_BAD-01          --MAAKFSLCSDSDSEPSEEVEEGERGSFSTSG-RIRVNSESQASAVSRD
A0A3B5L9R9_BAD-01      --MDTKFTI-SDGESDPSEDVEE--------RG-DLQLMQEKEKPLSQRH
A0A3B1IH05_BAD-01      FTMDHMFTI--SDESDASEELGDS--DQPEVSK-TAEP-------SRSGQ
Q4V925_BAD-02          --MAHMFNISDDSETETMEDSEDSSLDKHKSGS-AQKK-----------Q
Q4V925_BAD-03          --MAHMFNISDDSETETMEDSEDSSLDKHKSGS-AQKK-----------Q
A7MCM4_BAD-01          --MAHMFNISDDSETETMEDSEASSLDKHKSGS-AQKK-----------Q
Q4V925_BAD-04          --MAHMFNISDDSETETMEDSEDSSLDKHKSGS-AQKK-----------Q
Q4V925_BAD-01          --MAHMFNISDDSETETMEDSEDSSLDKHKSGS-AQKK-----------Q
A0A3B3BQF7_BAD-01      --MAAKFSI-SDNDSESSEEVEGG--RLDLAAS-GGEGGGGGGGHLHDRH
A0A2U9BAC9_BAD-01      --MAANFTI-SDSESEPSEEVEEG--EVSQPWT-GPGE------QVPPRH
A0A3B4VFC5_BAD-01      --MAANFTI-SDSESEPSEEVDEG--EMSQSLT-GQEQ------ELSQRH
A0A3B4W9T1_BAD-01      --MAANFTI-SDSESEPSEEVDEG--EMSQSLT-GQEQ------ELSQRH
A0A3B3QX41_BAD-01      VTMAHMFTI-SGNESDTSES------DTPDVTA-NSQL------GNNLK-
A0A1W4YVX7_BAD-01      --MDRMFSI-SDNESETSD-------ETADSEA-VSQP------ASQLEH
A0A1W4YVX7_BAD-02      VTMDRMFSI-SDNESETSD-------ETADSEA-VSQP------ASQLEH
A0A3B5K831_BAD-01      --MATRFSISSDSDSDPSEEVDEG--ERNSSLS-EQER------QVLQRH
A0A087X8P8_BAD-01      --MDAKFTI-SDSDSEPSEDVEER--GNLQLMQ-VKER------PLSQRH
A0A3B3UA11_BAD-01      --MDAKFTI-SDSDSEPSEDVEER--GNLQLMQ-VKER------PLSQRH
A0A3B3YFR1_BAD-01      --MDAKFTI-SDSDSEPSEDVEER--GNLQLMQ-VKER------PLSQRH
A0A3B5Q2N7_BAD-01      --MDTKFTI-SDGESDPSEDVEER--GDLQLMQ-EKEK------PLSQRH
A0A3B3HDU2_BAD-01      --MAAKFTI-SDDSESSEE-VEGGKLDLGAAAG-GEGE------HLHDRH
G3Q8B3_BAD-01          --MAAHFTI-SDSESEPSDGVEER--EDGQLSS-GQEQ------QRLQRH
A0A3B5BAL2_BAD-01      --MAAQFSI-SGSESDPEE-VEEG--ENNHPPA-EQPM------HVFERR
A0A2D0SYM2_BAD-01      NQYLLRLRK-ARFNFDKEEYTKVINTRIGSEGGGTILN------HFFGNS
A0A3B4DUY7_BAD-01      NQYLQKLRR-ARFNCEEERYKKVIKTLTGEK--GTPFN------PLCWNS
G1SS60_BAD-01          --------------------------------------------------
A0A337SAW2_BAD-01      AWAQSMFQI-PEFEPSEQEDSSPTDRGLGPSPTGDRP-------RGPGKH
A0A2I3TBK7_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2R8Z697_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSSKH
A0A2I2Z8C7_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
Q92934_BAD-03          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2K5M0C1_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2K5XJR2_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2I3MCN5_BAD-03      -----MFQI-PEFEPSEQEDSRSAERGLGPSPAGDKP-------SDSGKH
A0A2K5VCD8_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
F7GVS7_BAD-02          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K6E7J3_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K5E6K7_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDRP-------PGSGKH
A0A2K6TG62_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDSP-------PGSGKH
A0A2K5E6K7_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDRP-------PGSGKH
A0A2K5HKW9_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K6N1A1_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K6PUM5_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K5M0C1_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2K5VCD8_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
F7GVS7_BAD-03          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K5XJR2_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2I3MCN5_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDKP-------SDSGKH
A0A2K6E7J3_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2I2Z8C7_BAD-04      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
Q92934_BAD-04          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2I3TBK7_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2R8Z697_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSSKH
F6SJL0_BAD-02          -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDRP-------PGSGKH
A0A2K6TG62_BAD-03      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDSP-------PGSGKH
G1P8C5_BAD-01          PTAQSMFQI-PEFEHSEQEDSSPADRGLGPCPTGDQP-------PGLNKH
W5P8G9_BAD-01          AWAQSMFQI-PEFEQSEQEDSSPADRGLGPSPTGDRP-------PGLSKH
G3VRY4_BAD-02          -----MFQI-SEFEPSEPGEDPSASTAPSLAPLRPGPR------AAPGAH
G3VRY4_BAD-01          -----MFQI-SEFEPSEPGEDPSASTAPSLAPLRPGPR------AAPGAH
I3MBM5_BAD-02          AWTQSMFQI-PEFEPSEQEDSSSAEGGLGPSPAGDRP-------G-----
I3MBM5_BAD-01          AWTQSMFQI-PEFEPSEQEDSSSAEGGLGPSPAGDRP-------G-----
Q61337_BAD-03          -----MFQI-PEFEPSEQEDASATDRGLGPSLTEDQP-------G-----
Q61337_BAD-01          A-AQSMFQI-PEFEPSEQEDASATDRGLGPSLTEDQP-------G-----
Q61337_BAD-02          A-AQSMFQI-PEFEPSEQEDASATDRGLGPSLTEDQP-------G-----
G3TP47_BAD-01          GGLQSMFQI-PEFEQSDREDSTPADRGLGPSPEGYWP-------SGPSDR
F7DN67_BAD-01          PAAGSMFQI-PEFEQSEPEDSSPADRGLGPSPTGDWP-------SDPVRH
G1MI17_BAD-01          PTAQSMFQI-PEFEPSEQEDSSPADRGLGPSPTGDQP-------PGPGKH
A0A287AEF3_BAD-01      PASQSMFQI-PEFEQSEQEDSSPADRGLGPSPTGTDP-----------QP
O35147_BAD-01          PAAQSMFQI-PEFEPSEQEDASTTDRGLGPSLTEDQP-------G-----
M3YNE7_BAD-01          -----MFQI-PEFEPSEQEDSSPADRGLGPSPTGDQP-------PGLGKH
F1MUT9_BAD-01          -----MFQI-PEFEQSEQEDSSPADRGLGPSPTGDRP-------PGLSKH
Q3SYZ0_BAD-01          -----MFQI-PEFEQSEQEDSSRADRGLGPSPTGDRP-------PGLSKH
H0WVR2_BAD-01          -----MFQI-PEFEPSEQEDSSSSDRGLGPSPSGDQP-------LGPGKN
H0V608_BAD-01          -----MFQI-PEFEPSEQEDSSSEERGLGPSPTGDEL-------GSS---
A0A2K5E6K7_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDRP-------PGSGKH
A0A2K6TG62_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDSP-------PGSGKH
A0A0D9R491_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGNRP-------SDSGKH
A0A2K5M0C1_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2K5VCD8_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
F7GVS7_BAD-01          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K6E7J3_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K5XJR2_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSLAGDRP-------SDCGKH
A0A2I3MCN5_BAD-04      -----MFQI-PEFEPSEQEDSRSAERGLGPSPAGDKP-------SDSGKH
A0A2K6N1A1_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K6PUM5_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
A0A2K5HKW9_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SDSGKH
B4DZQ9_BAD-01          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2K6GWV0_BAD-01      -----MFQI-PEFEPSEQEDSSSAGRGLGPSPSGDRP-------SGPGKH
F6SJL0_BAD-01          -----MFQI-PEFEPSEQEDSSSAERGLSPSTAGDRP-------PGSGKH
A0A2I3MCN5_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDKP-------SDSGKH
A0A2I2Z8C7_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2I2Z8C7_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
Q92934_BAD-01          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
Q92934_BAD-02          -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2I3TBK7_BAD-02      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSGKH
A0A2R8Z697_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDGP-------SGSSKH
A0A2J8TYJ3_BAD-01      -----MFQI-PEFEPSEQEDSSSAERGLGPSPAGDRP-------SGSSKH
F1PK10_BAD-01          PTAQSMFQI-PEFEPSEQEDSSPANRGLGPSPTGDRP-------PSPGKH
Q45KI9_BAD-01          -----MFQI-PEFEPSEQEDSSPANRGLGPSPTGDRP-------PSPGKH
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          PYLAPG-----LLGSIV-QQ----------------QPGQAANN------
A0A287AEF3_BAD-02      APASPGARPQATWGKLV-TSRGSRPAAATMEALGLWRPGVATAL------
C1C3S9_BAD-01          HKSSPNLRRIKGKETRQ-RTESASEA------------------------
F6Z067_BAD-01          AKSSPSLRRYPGKESRL-RTESASES------------------------
A0A3B1JLM2_BAD-01      TDSGPSMYRDTSSDELLEVGGRVRLYSESQVYNINRWEDNENQD------
A0A3B4CPH6_BAD-01      -----ELSQSGQHPLVP-ERFRESRQ-RNHSMNEDALQESGAVR------
E7FBJ6_BAD-01          HQDRTSANISPQGRVRL-YSESQVYT--VSRWQDTETQD--GAS------
B5XEF1_BAD-01          ----------PGERVRL-YSESQVRS-QVGKREDTEFQDVMTPT------
I3K7B6_BAD-01          TLALPVIKTT---------VQPNQWN-ALGMRDE-DLMARGEDE------
A0A3B4GXJ6_BAD-01      TLSLPVIKTTAA--GRL-RVNSESHT-SSIARDE-ELMARGEDE------
B5X1T1_BAD-01          VSTRTGIRPRPGGRVRL-YSESQVCS-QVGRRDNTEFQDVMTPT------
H3ANP3_BAD-03          SRTAPNLQNPGPHQSHP-PSHTGVYG-WVKLRKRNNMEILGRPS------
H3ANP3_BAD-01          SRTAPNLQNPGPHQSHP-PSH-------T-----DNMEILGRPS------
H3ANP3_BAD-02          SRTAPNLQNPGPHQSHP-PSH-------T-----DNMEILGRPS------
H3ANP3_BAD-04          SRTAPNLQNPGPHQSHP-PSHTVFWG-FT-----DNMEILGRPS------
H3D8J8_BAD-01          E----------------------------------ELQGNGDDE------
A0A3B5L9R9_BAD-01      TLTLPELRSTKV-----------------------ELQARGEEE------
A0A3B1IH05_BAD-01      HITVPE------------KLRVEPRQ-RNFSMNEEALQESGAGR------
Q4V925_BAD-02          HLTVPD-RLKGEQLGRQ-R---------NLSMNEEDLLETGVAE------
Q4V925_BAD-03          HLTVPD-RLKGEQLGRQ-R---------NLSMNEEDLLETGVAE------
A7MCM4_BAD-01          HLTVPD-RLKGEQLGRQ-R---------NLSMNEEDLLETGVAE------
Q4V925_BAD-04          HLTVPD-RLKGEQLGRQ-R---------NLSMNEEDLLETGVAE------
Q4V925_BAD-01          HLTVPD-RLKGEQLGRQ-R---------NLSMNEEDLLETGVAE------
A0A3B3BQF7_BAD-01      ALTLPELRLTSN--GRT-RLNSESTV-STYSRDE-DLPR--EDE------
A0A2U9BAC9_BAD-01      TLALPELRMAAT--GRI-RLNSESNA-STLSRDE-ELLTRWDEE------
A0A3B4VFC5_BAD-01      TLTLPELRGAAT--GRT-RLNSESHT-STVSRDE-EFQARGEEE------
A0A3B4W9T1_BAD-01      TLTLPELRGAAT--GRT-RLNSESHT-STVSRDE-EFQARGEEE------
A0A3B3QX41_BAD-01      -----NTKNPGEAGGRV-RMRSESQV-SSIRSEDLDFGEGGASE------
A0A1W4YVX7_BAD-01      ALTVPDIKLSGEPGSRV-RVLSESEV-SLGRSEEPDLNNRAVSD------
A0A1W4YVX7_BAD-02      ALTVPDIKLSGEPGSRV-RVLSESEV-SLGRSEEPDLNNRAVSD------
A0A3B5K831_BAD-01      TLTLPELRLTGT--SRT-RVSSESQA-STFSREE-ELQGNVEDE------
A0A087X8P8_BAD-01      TLTLPELR-STT--GRV-RLNSESIA-STISREE-ELQARGEEE------
A0A3B3UA11_BAD-01      TLTLPELR-STT--GRV-RLNSESIA-STISREE-ELQARGEEE------
A0A3B3YFR1_BAD-01      TLTLPELR-STT--GRV-RLNSESIA-STISREE-ELQARGEEE------
A0A3B5Q2N7_BAD-01      TLTLPELR-STT--GRV-RLNSESIA-STISREV-ELQARGEEE------
A0A3B3HDU2_BAD-01      SLTLPELRLTSN--GRT-RLNSESTA-STYSRDE-DLAR--EDE------
G3Q8B3_BAD-01          TLTLPEL-----------RLSGRKSQ-RIVEKEE-ELWL---DE------
A0A3B5BAL2_BAD-01      NLALPELRTPAA--GRI-RLNSESHA-TTVSRDE-ELQARGEEE------
A0A2D0SYM2_BAD-01      SRITAFTMDETPQSVRG-DAGPVDDK-ESRWSET---VENTDSP------
A0A3B4DUY7_BAD-01      LRTTACAMEKHSED--G-ISTMDDQD-ESNWSET---VKNGDSPQLDSQH
G1SS60_BAD-01          ------------------PRPKPLSA-GAGAMETR--SRHSSYP------
A0A337SAW2_BAD-01      QRTTPGLLGEAGHQQGQ-PASSNHHG-GAGAVETR--SRHSSYP------
A0A2I3TBK7_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNPD------
A0A2R8Z697_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNAD------
A0A2I2Z8C7_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERRHSNAD------
Q92934_BAD-03          HRQAPGLLWDASHQQEQ-PTSSSHHG-EGT--SSPEERGHSNAD------
A0A2K5M0C1_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
A0A2K5XJR2_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
A0A2I3MCN5_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
A0A2K5VCD8_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
F7GVS7_BAD-02          HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
A0A2K6E7J3_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GT---SSPEERGHSDAD------
A0A2K5E6K7_BAD-02      PRQAPGLPGDASHQQGQ-PTSSSHHG-GT---SSPEERGHSNAD------
A0A2K6TG62_BAD-02      RRQAPGLPGDASHQQGQ-PTSSSHHG-GT---SSPEERGHSNAD------
A0A2K5E6K7_BAD-03      PRQAPGLPGDASHQQGQ-PTSSSHHG-GE--YSTCASASSSENP------
A0A2K5HKW9_BAD-02      HRQAPGLLWDASHQQEQ-ATSSSHHG-GRAWYSPS-ESEDSENP------
A0A2K6N1A1_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYYPA-ESEDSENP------
A0A2K6PUM5_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYYPA-ESEDSENP------
A0A2K5M0C1_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GGAWYSPSWESEDSENP------
A0A2K5VCD8_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENP------
F7GVS7_BAD-03          HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENP------
A0A2K5XJR2_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GGAWYSPSWESEDSENP------
A0A2I3MCN5_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENP------
A0A2K6E7J3_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRAWYSPSWESEDSENP------
A0A2I2Z8C7_BAD-04      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENP------
Q92934_BAD-04          HRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENP------
A0A2I3TBK7_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENP------
A0A2R8Z697_BAD-03      HRQAPGLLWDASHQQEQ-PTSSSHHG-GRTSYSPSWESEDSENP------
F6SJL0_BAD-02          RRQAPGLPGDASHQQGQ-STSSSHHG---------------ENP------
A0A2K6TG62_BAD-03      RRQAPGLPGDASHQQGQ-PTSSSHHG---------------ENP------
G1P8C5_BAD-01          WSTVPGLLGEAGHQQGQ-PASSSHHD-GAGSVEPR--SRHSSYP------
W5P8G9_BAD-01          WLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYP------
G3VRY4_BAD-02          HHEKGGAQKSQTHVSKELKASASQGRLGKGSFEGREGSREASPE------
G3VRY4_BAD-01          HHEGAGAGRPRLISYPPL----------------REGSREASPE------
I3MBM5_BAD-02          CGLAPGLPRDTGHQQWQ-ATSSSNHG-GAGATETR--SRHSSYP------
I3MBM5_BAD-01          CGLAPGLPRDTGHQQWQ-ATSSSNHG-GAGATETR--SRHSSYP------
Q61337_BAD-03          PYLAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYP------
Q61337_BAD-01          PYLAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYP------
Q61337_BAD-02          PYLAPGLLGSNIHQQGR-AATNSHHG-GAGAMETR--SRHSSYP------
G3TP47_BAD-01          HRVAPGFLRDSSHQQGQ-PTSSGHHG-GAAAVETR--SRHSSYP------
F7DN67_BAD-01          QRTAPGLLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYP------
G1MI17_BAD-01          RQTAPGLLGEAAHPQGQ-PASSNHHG-GAGAVEPR--SRHSSYP------
A0A287AEF3_BAD-01      WRTAPGHLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYP------
O35147_BAD-01          PYLAPGLLGSIVQQQPGQAANNSHHG-GAGTMETR--SRHSSYP------
M3YNE7_BAD-01          LQTAPGLLGEAGHQQGQ-PASSSHHG-GAGAVETR--SRHSSYP------
F1MUT9_BAD-01          WLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYR------
Q3SYZ0_BAD-01          WLTAPGLLGEAGHQQGQ-PAGSSHHG-GTGAVETR--SRHSSYR------
H0WVR2_BAD-01          RCTTPSLLGDASHLQGQ-PASNTHHGAGPGAVETR--SRHSSYP------
H0V608_BAD-01          --PAGGFLGDTSHQQRQLRSSRSHHG-GTVAMETR--SRHRSYP------
A0A2K5E6K7_BAD-01      PRQAPGLPGDASHQQGQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K6TG62_BAD-01      RRQAPGLPGDASHQQGQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A0D9R491_BAD-01      HHQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K5M0C1_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K5VCD8_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
F7GVS7_BAD-01          HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K6E7J3_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K5XJR2_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2I3MCN5_BAD-04      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K6N1A1_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K6PUM5_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2K5HKW9_BAD-01      HRQAPGLLWDASHQQEQ-ATSSSHHG-GAGAVETR--SRHSSHP------
B4DZQ9_BAD-01          HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
A0A2K6GWV0_BAD-01      PCTAPSFLGDASHQQGQ-PSSSSHHG-GAGSVETR--SRHSSYP------
F6SJL0_BAD-01          RRQAPGLPGDASHQQGQ-STSSSHHG-GAGAVETR--SRHSSYP------
A0A2I3MCN5_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVETR--SRHSSYP------
A0A2I2Z8C7_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
A0A2I2Z8C7_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
Q92934_BAD-01          HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
Q92934_BAD-02          HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
A0A2I3TBK7_BAD-02      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
A0A2R8Z697_BAD-01      HRQAPGLLWDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
A0A2J8TYJ3_BAD-01      HRQAPGLLRDASHQQEQ-PTSSSHHG-GAGAVEIR--SRHSSYP------
F1PK10_BAD-01          QQTAPGLLGEAGHQQGQ-PASRKHHG-GAGA-ETR--SRHSSFP------
Q45KI9_BAD-01          QQTAPGLLGEAGHQQGQ-PASRKHHG-GAGA-ETR--SRHSSFP------
                                                                         

F7GVS7_BAD-04          --------------------------------------------------
Q2PG01_BAD-01          --------------------------------------------------
A0A2I3H4B2_BAD-01      --------------------------------------------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      --------------------------------------------------
C1C3S9_BAD-01          ----------------------------------------------SETD
F6Z067_BAD-01          ----------------------------------------------SETD
A0A3B1JLM2_BAD-01      -----------------------------------------GASAEDGGV
A0A3B4CPH6_BAD-01      -----------------------------------------HGD--GAAD
E7FBJ6_BAD-01          -----------------------------------------VE---ENGD
B5XEF1_BAD-01          -----------------------------------------EE---GGGD
I3K7B6_BAD-01          -----------------------------------------VC---TPTE
A0A3B4GXJ6_BAD-01      -----------------------------------------VC---TPTE
B5X1T1_BAD-01          -----------------------------------------EE---GGGD
H3ANP3_BAD-03          -----------------------------------------SESQISDSE
H3ANP3_BAD-01          -----------------------------------------SESQISDSE
H3ANP3_BAD-02          -----------------------------------------SESQISDSE
H3ANP3_BAD-04          -----------------------------------------SESQISDSE
H3D8J8_BAD-01          -----------------------------------------AG---TPTD
A0A3B5L9R9_BAD-01      -----------------------------------------VG---TPTE
A0A3B1IH05_BAD-01      -----------------------------------------HED--GARD
Q4V925_BAD-02          -----------------------------------------D----PHML
Q4V925_BAD-03          -----------------------------------------D----PHML
A7MCM4_BAD-01          -----------------------------------------D----PHML
Q4V925_BAD-04          -----------------------------------------D----PHML
Q4V925_BAD-01          -----------------------------------------D----PHML
A0A3B3BQF7_BAD-01      -----------------------------------------AG---TPTD
A0A2U9BAC9_BAD-01      -----------------------------------------AG---TPTD
A0A3B4VFC5_BAD-01      -----------------------------------------AG---TPTE
A0A3B4W9T1_BAD-01      -----------------------------------------AG---TPTE
A0A3B3QX41_BAD-01      -----------------------------------------EGGGVCPGD
A0A1W4YVX7_BAD-01      -----------------------------------------EGGGGGAGD
A0A1W4YVX7_BAD-02      -----------------------------------------EGGGGGAGD
A0A3B5K831_BAD-01      -----------------------------------------AG---TPTE
A0A087X8P8_BAD-01      -----------------------------------------VG---TPTE
A0A3B3UA11_BAD-01      -----------------------------------------VG---TPTE
A0A3B3YFR1_BAD-01      -----------------------------------------VG---TPTE
A0A3B5Q2N7_BAD-01      -----------------------------------------VG---TPTE
A0A3B3HDU2_BAD-01      -----------------------------------------AG---TPTD
G3Q8B3_BAD-01          -----------------------------------------TG---TPTE
A0A3B5BAL2_BAD-01      -----------------------------------------AG---TPTD
A0A2D0SYM2_BAD-01      ---------------SVGGRVRLYSESQVHTVSRWEDAELQDGISAEESG
A0A3B4DUY7_BAD-01      SMASNISPASPDELSEVGCRVRLYSESQVYTVSRWQDNE--DGLLAED-G
G1SS60_BAD-01          -----------------------------------------ADADDSEGA
A0A337SAW2_BAD-01      -----------------------------------------AGTEEDEGT
A0A2I3TBK7_BAD-01      -----------------------------------------AAKLQLDAS
A0A2R8Z697_BAD-02      -----------------------------------------AAKLQLDAS
A0A2I2Z8C7_BAD-03      -----------------------------------------AAKLQLDAS
Q92934_BAD-03          -----------------------------------------AAKLQLDAS
A0A2K5M0C1_BAD-02      -----------------------------------------AAKLQLDAS
A0A2K5XJR2_BAD-02      -----------------------------------------AAKLQLDAS
A0A2I3MCN5_BAD-03      -----------------------------------------AAKLQLDAS
A0A2K5VCD8_BAD-02      -----------------------------------------AAKLQLDAS
F7GVS7_BAD-02          -----------------------------------------AAKLQLDAS
A0A2K6E7J3_BAD-02      -----------------------------------------AAKLQLDAS
A0A2K5E6K7_BAD-02      -----------------------------------------AAKLQLDAS
A0A2K6TG62_BAD-02      -----------------------------------------AAKLQLDAS
A0A2K5E6K7_BAD-03      -----------------------------------------SARMLSKAS
A0A2K5HKW9_BAD-02      -----------------------------------------SARMLTEAS
A0A2K6N1A1_BAD-02      -----------------------------------------SARMLAEAS
A0A2K6PUM5_BAD-02      -----------------------------------------SARMLAEAS
A0A2K5M0C1_BAD-03      -----------------------------------------SARMLAEAS
A0A2K5VCD8_BAD-03      -----------------------------------------SARMLAEAS
F7GVS7_BAD-03          -----------------------------------------SARMLAEAS
A0A2K5XJR2_BAD-03      -----------------------------------------SARMLAEAS
A0A2I3MCN5_BAD-02      -----------------------------------------SARMLAEAS
A0A2K6E7J3_BAD-03      -----------------------------------------SARMLAEAS
A0A2I2Z8C7_BAD-04      -----------------------------------------SAGMLAEAS
Q92934_BAD-04          -----------------------------------------SAGMLAEAS
A0A2I3TBK7_BAD-03      -----------------------------------------SAGMLAEAS
A0A2R8Z697_BAD-03      -----------------------------------------SAGMLAEAS
F6SJL0_BAD-02          -----------------------------------------SVRMFSKAS
A0A2K6TG62_BAD-03      -----------------------------------------SAKMLSKAS
G1P8C5_BAD-01          -----------------------------------------TGTEEDDDT
W5P8G9_BAD-01          -----------------------------------------AGPEDDEGT
G3VRY4_BAD-02          -----------------------------------------AEAEAEQSE
G3VRY4_BAD-01          -----------------------------------------AEAEAEQSE
I3MBM5_BAD-02          -----------------------------------------ADTDLDEGM
I3MBM5_BAD-01          -----------------------------------------ADTDLDEGM
Q61337_BAD-03          -----------------------------------------AGTEEDEGM
Q61337_BAD-01          -----------------------------------------AGTEEDEGM
Q61337_BAD-02          -----------------------------------------AGTEEDEGM
G3TP47_BAD-01          -----------------------------------------AGSDEAEGL
F7DN67_BAD-01          -----------------------------------------EGTEDEGME
G1MI17_BAD-01          -----------------------------------------AGTEEDEGL
A0A287AEF3_BAD-01      -----------------------------------------EGTEEDEGT
O35147_BAD-01          -----------------------------------------AGTEEDEGM
M3YNE7_BAD-01          -----------------------------------------AGTEEDEGM
F1MUT9_BAD-01          -----------------------------------------AGPEDNEET
Q3SYZ0_BAD-01          -----------------------------------------AGPEDNEET
H0WVR2_BAD-01          -----------------------------------------AGTEEDEGI
H0V608_BAD-01          -----------------------------------------AGTEEEEGM
A0A2K5E6K7_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K6TG62_BAD-01      -----------------------------------------AGTEGDEGM
A0A0D9R491_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K5M0C1_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K5VCD8_BAD-01      -----------------------------------------AGTEEDEGM
F7GVS7_BAD-01          -----------------------------------------AGTEEDEGM
A0A2K6E7J3_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K5XJR2_BAD-01      -----------------------------------------AGTEEDEGM
A0A2I3MCN5_BAD-04      -----------------------------------------AGTEEDEGM
A0A2K6N1A1_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K6PUM5_BAD-01      -----------------------------------------AGTEEDEGM
A0A2K5HKW9_BAD-01      -----------------------------------------AGTEEDEGM
B4DZQ9_BAD-01          -----------------------------------------AGTEDDEGM
A0A2K6GWV0_BAD-01      -----------------------------------------AGTEEDEGM
F6SJL0_BAD-01          -----------------------------------------AGTEEDEGM
A0A2I3MCN5_BAD-01      -----------------------------------------AGTEEDEGM
A0A2I2Z8C7_BAD-02      -----------------------------------------AGTEDDEGM
A0A2I2Z8C7_BAD-01      -----------------------------------------AGTEDDEGM
Q92934_BAD-01          -----------------------------------------AGTEDDEGM
Q92934_BAD-02          -----------------------------------------AGTEDDEGM
A0A2I3TBK7_BAD-02      -----------------------------------------AGTEDDEGM
A0A2R8Z697_BAD-01      -----------------------------------------AGTEDDEGM
A0A2J8TYJ3_BAD-01      -----------------------------------------AGTEDDEGM
F1PK10_BAD-01          -----------------------------------------AGTDEDEGM
Q45KI9_BAD-01          -----------------------------------------AGTDEDEGM
                                                                         

F7GVS7_BAD-04          ------PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKVSAGPPPRP
Q2PG01_BAD-01          ------PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK----GLPRP
A0A2I3H4B2_BAD-01      ------PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK----GLPRP
Q6P7C5_BAD-01          ---------------------SHHGGRFLTSIIFLSHVP-----------
A0A287AEF3_BAD-02      ---------------------TQRGPRRMKGLRMRSSAPSA--ADRSRRP
C1C3S9_BAD-01          SVGELQHFRSRSRSAPSSLMVAARYGRELRRMSDEFDQIF---TS-IPRP
F6Z067_BAD-01          KVGELHPFRSRSRSAPSS-MIATKYGRELRRMSDEFEKSF---TG-LPRP
A0A3B1JLM2_BAD-01      GDGA--PFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD--KGDLRRT
A0A3B4CPH6_BAD-01      GD----SFRRRCRSAPPALWAAKKYGRQLRKMSDEFDTLLD--KG-MKRV
E7FBJ6_BAD-01          GL----PFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD--KG-VSK-
B5XEF1_BAD-01          GA----SFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLD--KG-VPKR
I3K7B6_BAD-01          GD----PFRRRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD--KGEMK--
A0A3B4GXJ6_BAD-01      GD----PFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD--KGEMK--
B5X1T1_BAD-01          GA----PFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLD--KGEPKRG
H3ANP3_BAD-03          SLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS--FLGLPRP
H3ANP3_BAD-01          SLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS--FLGLPRP
H3ANP3_BAD-02          SLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS--FLGLPRP
H3ANP3_BAD-04          SLDELGPFRTRSRSAPPNFWAARKYGQELRRMSDEFD--MS--FLGLPRP
H3D8J8_BAD-01          GA----PFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLD--KGGMRKT
A0A3B5L9R9_BAD-01      GF----PFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLD--KGEMRNV
A0A3B1IH05_BAD-01      GD----SFRRRSRSAPPSLWAAKKYGRQLRKMSDEFDKGLE--QG-MKRV
Q4V925_BAD-02          GD----PFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D--KG-MKRV
Q4V925_BAD-03          GD----PFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D--KG-MKRV
A7MCM4_BAD-01          GD----PFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D--KGQMKRV
Q4V925_BAD-04          GD----PFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D--KGQMKRV
Q4V925_BAD-01          GD----PFRPRSRSAPPALWAAKKYGQQLRRMSDEF----D--KGQMKRV
A0A3B3BQF7_BAD-01      GL----AFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD--KGEMRKV
A0A2U9BAC9_BAD-01      GA----PFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLD--KGEMRKV
A0A3B4VFC5_BAD-01      GA----PFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD--KGEMRKV
A0A3B4W9T1_BAD-01      GA----PFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD--KGEMRKV
A0A3B3QX41_BAD-01      GT----PFRGRSRSAPPALWAAQRYGRQLRRMSDEFDTLLD--KG-MKRV
A0A1W4YVX7_BAD-01      GT----HFRTRSQSAPPALWAAQRYGRQLRRMSDEFDTLLD--KG-MKRV
A0A1W4YVX7_BAD-02      GT----HFRTRSQSAPPALWAAQRYGRQLRRMSDEFDTLLD--KG-MKRV
A0A3B5K831_BAD-01      GA----PFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLD--KGGMRKT
A0A087X8P8_BAD-01      GF----PFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD--KGEMRKV
A0A3B3UA11_BAD-01      GF----PFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD--KGEMRKV
A0A3B3YFR1_BAD-01      GF----PFRGRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLD--KGEMRKV
A0A3B5Q2N7_BAD-01      GF----PFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLD--KGEMRNV
A0A3B3HDU2_BAD-01      GL----AFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLD--KGEMRKV
G3Q8B3_BAD-01          GA----PFRVRSKSAPPALWAAKKYGRQLRRMSDEFDSLLD--KGEMRRV
A0A3B5BAL2_BAD-01      GA----PFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLD--KGEMKRV
A0A2D0SYM2_BAD-01      GASDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD--RG-DIRR
A0A3B4DUY7_BAD-01      GAGDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLD--KG-DTRR
G1SS60_BAD-01          EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSVK--KG-LPRP
A0A337SAW2_BAD-01      EEEEPSPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSF---KG-LPRP
A0A2I3TBK7_BAD-01      LPVLVGSELGQG---------------KLRPLPVTFAPHP---ET-PPVP
A0A2R8Z697_BAD-02      LPVLVGSELGQG---------------KLRPLPVTFAPHP---ET-PPVP
A0A2I2Z8C7_BAD-03      LPVLVGSELGQG---------------KLRPLPVTFAAHP---ET-PPVP
Q92934_BAD-03          LPVLVGSELGQG---------------KLRPLPVTFAPHP---ET-PPVP
A0A2K5M0C1_BAD-02      LPVLVGSELGQG---------------KLRPLPVTFAPRP---ET-PPAL
A0A2K5XJR2_BAD-02      LPVLVGSELGQG---------------KLRPLPVTFAPRP---ET-PPAL
A0A2I3MCN5_BAD-03      LPVLVGSELGQG---------------KLRPLPVTFAPRP---ET-PPAL
A0A2K5VCD8_BAD-02      LPVLVGSELGQG---------------KLRTLPVTFAPRP---ET-PPAL
F7GVS7_BAD-02          LPVLVGSELGQG---------------KLRTLPVTFAPRP---ET-PPAL
A0A2K6E7J3_BAD-02      LPVLVGSELGQG---------------KLRTLPVTFAPRP---ET-PPAL
A0A2K5E6K7_BAD-02      HPVLVGSELGQG---------------RLRSLPVTFAPHP---ET-PPVP
A0A2K6TG62_BAD-02      HPVLVGSELGQG---------------RLRSLPVTFAPHP---ET-LPAP
A0A2K5E6K7_BAD-03      AGMSAPATDS-----E---------NVKLE-VPC-W---V---AT-APTP
A0A2K5HKW9_BAD-02      AGMSAPATDSEAQHAE---------NVKLEALGL-WRPGV---AT-APTP
A0A2K6N1A1_BAD-02      AGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV---AT-APTP
A0A2K6PUM5_BAD-02      AGMSAPATDSEAQLAE---------NVKLEALGL-WRPGV---AT-APTP
A0A2K5M0C1_BAD-03      ARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV---AT-APTP
A0A2K5VCD8_BAD-03      ARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV---AT-APTP
F7GVS7_BAD-03          ARMSAPATDSEAQHAE---------NVKLKALGL-WRPGV---AT-APTP
A0A2K5XJR2_BAD-03      ARMSAPATDSEAQLAE---------NVKLKALGL-WRPGV---AT-APTP
A0A2I3MCN5_BAD-02      APMSAPATDSEAQHAE---------NVKLKALGL-WRRGV---AT-APTP
A0A2K6E7J3_BAD-03      ARMSAPATDSEAQHAE---------NVKLKALGL-WRPAV---AT-APTP
A0A2I2Z8C7_BAD-04      AGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV---AT-APTP
Q92934_BAD-04          AGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV---AT-APTP
A0A2I3TBK7_BAD-03      AGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV---AT-APTP
A0A2R8Z697_BAD-03      AGMSAPAADSEAQHAE---------NVKLEALGL-WRSGV---AT-APTP
F6SJL0_BAD-02          AGMSAPATDSEAQHTE---------NVKLEALGL-WRPGV---AT-ARTP
A0A2K6TG62_BAD-03      AGMSAPATDSEAQHTE---------NVKLEALEP-WRHGV---AT-ARTP
G1P8C5_BAD-01          EEGEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFQGSFK--KG-LPRP
W5P8G9_BAD-01          EEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF---KG-LPRP
G3VRY4_BAD-02          GEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF---KG-LPRP
G3VRY4_BAD-01          GEEERGLFRGRSSSAPPILWAARHYGSELRRMSDEFHCTF---KG-LPRP
I3MBM5_BAD-02          EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---K------
I3MBM5_BAD-01          EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---KG-LPRP
Q61337_BAD-03          EEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---KG-LPRP
Q61337_BAD-01          EEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---KG-LPRP
Q61337_BAD-02          EEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---KG-----
G3TP47_BAD-01          EEDP-SPFRGRSLSAPPNLWAAQRYGRELRRMSDEFQGYF---KG-LPRP
F7DN67_BAD-01          GEEP-GPFRGRSRSAPPNLWAARRYGRELRRMSDEFQVSF---QA-LPRP
G1MI17_BAD-01          EEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSF---KG-LPRP
A0A287AEF3_BAD-01      EDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEFQGSF---KG-LPRP
O35147_BAD-01          EEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSF---KG-LPRP
M3YNE7_BAD-01          EEEELSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSF---KG-LPRP
F1MUT9_BAD-01          EEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF---KG-LPRP
Q3SYZ0_BAD-01          EEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSF---KG-LPRP
H0WVR2_BAD-01          -EEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFK--KG-LPRP
H0V608_BAD-01          EEEL-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K5E6K7_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K6TG62_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A0D9R491_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K5M0C1_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K5VCD8_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
F7GVS7_BAD-01          EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K6E7J3_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K5XJR2_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2I3MCN5_BAD-04      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K6N1A1_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K6PUM5_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
A0A2K5HKW9_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSF---KG-LPRP
B4DZQ9_BAD-01          GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2K6GWV0_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEDSFK--KG-LPRP
F6SJL0_BAD-01          EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2I3MCN5_BAD-01      EEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2I2Z8C7_BAD-02      GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2I2Z8C7_BAD-01      GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
Q92934_BAD-01          GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
Q92934_BAD-02          GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2I3TBK7_BAD-02      GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2R8Z697_BAD-01      GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
A0A2J8TYJ3_BAD-01      GEEP-SPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFK--KG-LPRP
F1PK10_BAD-01          EEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF---KG-LPRP
Q45KI9_BAD-01          EEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSF---KG-LPRP
                                                   :  :                  

F7GVS7_BAD-04          PRAGLSLPCPKARP-----------DLMSHDPSPTPSCPFLAP-------
Q2PG01_BAD-01          KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I3H4B2_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
Q6P7C5_BAD-01          --------------------------------------------------
A0A287AEF3_BAD-02      PSSGLHSVMAASSGG-----------------------------------
C1C3S9_BAD-01          KSASAATEMTVSKSFGETFFNFFRRKNKDRSQSENDKH------------
F6Z067_BAD-01          KSASAAGQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE------------
A0A3B1JLM2_BAD-01      TGPGR----HTNRGWFSFLWGTKEEEGRE---------------------
A0A3B4CPH6_BAD-01      RSAGAARQMHASPSWFTFLWSHKESDSEASSSLTAPDTRPAE--------
E7FBJ6_BAD-01          ---TPNSQKQTYRGWFSFLWSPKEEEGRE---------------------
B5XEF1_BAD-01          GIIPRGGKQKVSRGWFSFLWSPKEAEGRE---------------------
I3K7B6_BAD-01          -----LKKLHHSKTWWSYLFSHQETEGENN--HLE---------------
A0A3B4GXJ6_BAD-01      -----VKKLHHSKTWWSYLFSHQETEGENN--HLENHNQRTE--------
B5X1T1_BAD-01          ISPGGVKQ-EVSRGWFSFLWSPKKAEGRE---------------------
H3ANP3_BAD-03          KSAGAAGEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQ--------
H3ANP3_BAD-01          KSAGAAGEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQQGVSIRGP
H3ANP3_BAD-02          KSAGAAGEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQQGVSIRGP
H3ANP3_BAD-04          KSAGAAGEMVDE-SWWKKLIRSLKGRGQPR-------DPPGQ--------
H3D8J8_BAD-01          SSAGSARQMHHSRSWWSYLFSHQETESENN--HHD---------------
A0A3B5L9R9_BAD-01      SSDGSNRPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------
A0A3B1IH05_BAD-01      RSAGAARQMQNSPSWFAFLWSHKESDSEAS------SSRPAE--------
Q4V925_BAD-02          KSAGTARQMSQSPSWLAFLWSHKESDAESR---------PAE--------
Q4V925_BAD-03          KSAGTARQMSQSPSWLAFLWSHKESDAESR---------PAE--------
A7MCM4_BAD-01          KSAGTARQMSQSPSWLAFLWSHKESDAESR---------PAE--------
Q4V925_BAD-04          KSAGTARQMSQSPSWLAFLWSHKESDAESR---------PAE--------
Q4V925_BAD-01          KSAGTARQMSQSPSWLAFLWSHKESDAESR---------PAE--------
A0A3B3BQF7_BAD-01      RSAGATKQMHHSTSWWNYLFSHPEAEGEYS--HHESH--RTE--------
A0A2U9BAC9_BAD-01      KSAGTARQMHHSQSWWSYLFSHQEMEGENN--HHENHTQRNE--------
A0A3B4VFC5_BAD-01      KSAGTAKQMHHSKSWWSYLFSHQETEGENN--HHENHTHRTE--------
A0A3B4W9T1_BAD-01      KSAGTAKQMHHSKSWWSYLFSHQETEGENN--HHENHTHRTE--------
A0A3B3QX41_BAD-01      RSAGAARQMQASPSWFAFLWSHKESDAEISGSLSTADSRAAQ--------
A0A1W4YVX7_BAD-01      RSAGAARQMQASPSWFAFLWSHKESEAEIS-----SGGRAAQ--------
A0A1W4YVX7_BAD-02      RSAGAARQMQASPSWFAFLWSHKESEAEIS-----SGGRAAQ--------
A0A3B5K831_BAD-01      NSTGSTKPMHHSRSWWSYLFSHQETEGENG--HHDGHTHRTE--------
A0A087X8P8_BAD-01      SSTGSNRPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------
A0A3B3UA11_BAD-01      SSTGSNRPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------
A0A3B3YFR1_BAD-01      SSTGSNRPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------
A0A3B5Q2N7_BAD-01      SSDGSNRPIHHSRSWWSYLFSHQETEGENN--HHENHASRTE--------
A0A3B3HDU2_BAD-01      RSTGAAKQMLHSTSWWNYLFSHPEAEGEYS--HHE--SHRTE--------
G3Q8B3_BAD-01          KSAGTTKQMQHSKSWWSSLFSHQEMEGENN--HHE---------------
A0A3B5BAL2_BAD-01      RSAGTAKQMHHSKSWWSYLFSHQELEGENN--HHENHTHRNE--------
A0A2D0SYM2_BAD-01      VSSPGKVSQKQSN------RGWFSFLWGSREEEEEGRE------------
A0A3B4DUY7_BAD-01      ASSPG----KQTN------RGWFSFLWGSK--EEEGRE------------
G1SS60_BAD-01          KSAGTAMQMRESSSWTRVIQSWWDRNLGKGGSAPSQ--------------
A0A337SAW2_BAD-01      KSAGTATQMRQSPSWTRFIQSWWDRNLGRGGSAPSQ--------------
A0A2I3TBK7_BAD-01      TALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTPIPFRCV--
A0A2R8Z697_BAD-02      TALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTQIPFRCV--
A0A2I2Z8C7_BAD-03      TALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGRLTQIPFRCV--
Q92934_BAD-03          TALGSHLEYGRKYFPQAYAK--------RGSVLSPLEGGLTQIPFRCV--
A0A2K5M0C1_BAD-02      TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5XJR2_BAD-02      TVLVGHLGYGRKCFPQASCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2I3MCN5_BAD-03      TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5VCD8_BAD-02      TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
F7GVS7_BAD-02          TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K6E7J3_BAD-02      TVLVGHLGYGRKCFPQALCK--------RGSVLPLSVGGLTQIPFRCM--
A0A2K5E6K7_BAD-02      IALGGHLGYGRKCFLQ---------------------GELTQIPFRCV--
A0A2K6TG62_BAD-02      IALGGHLGHGRKCFLQ---------------------GGLTQIPFRCV--
A0A2K5E6K7_BAD-03      QGRRRTKGWRRSPAPFGAVRAQHPPTSGQHSAMAASSGG-----------
A0A2K5HKW9_BAD-02      RGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K6N1A1_BAD-02      RGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K6PUM5_BAD-02      RGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG-----------
A0A2K5M0C1_BAD-03      RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2K5VCD8_BAD-03      RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
F7GVS7_BAD-03          RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2K5XJR2_BAD-03      RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2I3MCN5_BAD-02      RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2K6E7J3_BAD-03      RGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAASSGG-----------
A0A2I2Z8C7_BAD-04      RGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
Q92934_BAD-04          RGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
A0A2I3TBK7_BAD-03      RGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
A0A2R8Z697_BAD-03      RGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG-----------
F6SJL0_BAD-02          QGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG-----------
A0A2K6TG62_BAD-03      QGRRGTKGWRRSPALFGAVRARHPPTSGQHSDMAASSGG-----------
G1P8C5_BAD-01          KSAGTATQMWQKSSWTRFFQSWWDRNSGRGGSAPSQ--------------
W5P8G9_BAD-01          KSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
G3VRY4_BAD-02          KSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH--------------
G3VRY4_BAD-01          KSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH--------------
I3MBM5_BAD-02          ---------------VTFSQSPFLRA------------------------
I3MBM5_BAD-01          RSAGTASQMRQSSSWTRFIQSWWDRNLGRRGSAPSQ--------------
Q61337_BAD-03          KSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------------
Q61337_BAD-01          KSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------------
Q61337_BAD-02          ------EELTYSLSPFRCVQ------------------------------
G3TP47_BAD-01          KSAGTATQMRQSPSWTRIIQAWWDRNLGRGSSAPSQ--------------
F7DN67_BAD-01          KSAGTATQMRQSPSWTRAIQSWWDRNLGRGGSAPSQ--------------
G1MI17_BAD-01          KSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A287AEF3_BAD-01      KSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ--------------
O35147_BAD-01          KSAGTATQMRQSASWTRIIQSWWDRNLGKGGSTPSQ--------------
M3YNE7_BAD-01          KSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
F1MUT9_BAD-01          KSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
Q3SYZ0_BAD-01          KSAGTATEMRQSPSWTRFLQSWLSRNLGRGGSAPSQ--------------
H0WVR2_BAD-01          KSAGTATQMRQSSSWTRVIQSWWDRNVGRGGSAPCQ--------------
H0V608_BAD-01          KSAGTATKLWQNSNWTRAIQSWWDRNLGRGGSAPSQESV-----------
A0A2K5E6K7_BAD-01      KSAGTATQMRQSSSWTQVIQSWWDRNLGRGGSAPSQ--------------
A0A2K6TG62_BAD-01      KSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A0D9R491_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5M0C1_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5VCD8_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
F7GVS7_BAD-01          KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K6E7J3_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5XJR2_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I3MCN5_BAD-04      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K6N1A1_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K6PUM5_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2K5HKW9_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
B4DZQ9_BAD-01          KSAGTATQMRQSPRRLR---------------------------------
A0A2K6GWV0_BAD-01      KSAGTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ--------------
F6SJL0_BAD-01          KSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ--------------
A0A2I3MCN5_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I2Z8C7_BAD-02      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I2Z8C7_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
Q92934_BAD-01          KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
Q92934_BAD-02          KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2I3TBK7_BAD-02      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2R8Z697_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
A0A2J8TYJ3_BAD-01      KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ--------------
F1PK10_BAD-01          KSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
Q45KI9_BAD-01          KSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ--------------
                                                                         

F7GVS7_BAD-04          -
Q2PG01_BAD-01          -
A0A2I3H4B2_BAD-01      -
Q6P7C5_BAD-01          -
A0A287AEF3_BAD-02      -
C1C3S9_BAD-01          -
F6Z067_BAD-01          -
A0A3B1JLM2_BAD-01      -
A0A3B4CPH6_BAD-01      -
E7FBJ6_BAD-01          -
B5XEF1_BAD-01          -
I3K7B6_BAD-01          -
A0A3B4GXJ6_BAD-01      -
B5X1T1_BAD-01          -
H3ANP3_BAD-03          -
H3ANP3_BAD-01          D
H3ANP3_BAD-02          D
H3ANP3_BAD-04          -
H3D8J8_BAD-01          -
A0A3B5L9R9_BAD-01      -
A0A3B1IH05_BAD-01      -
Q4V925_BAD-02          -
Q4V925_BAD-03          -
A7MCM4_BAD-01          -
Q4V925_BAD-04          -
Q4V925_BAD-01          -
A0A3B3BQF7_BAD-01      -
A0A2U9BAC9_BAD-01      -
A0A3B4VFC5_BAD-01      -
A0A3B4W9T1_BAD-01      -
A0A3B3QX41_BAD-01      -
A0A1W4YVX7_BAD-01      -
A0A1W4YVX7_BAD-02      -
A0A3B5K831_BAD-01      -
A0A087X8P8_BAD-01      -
A0A3B3UA11_BAD-01      -
A0A3B3YFR1_BAD-01      -
A0A3B5Q2N7_BAD-01      -
A0A3B3HDU2_BAD-01      -
G3Q8B3_BAD-01          -
A0A3B5BAL2_BAD-01      -
A0A2D0SYM2_BAD-01      -
A0A3B4DUY7_BAD-01      -
G1SS60_BAD-01          -
A0A337SAW2_BAD-01      -
A0A2I3TBK7_BAD-01      -
A0A2R8Z697_BAD-02      -
A0A2I2Z8C7_BAD-03      -
Q92934_BAD-03          -
A0A2K5M0C1_BAD-02      -
A0A2K5XJR2_BAD-02      -
A0A2I3MCN5_BAD-03      -
A0A2K5VCD8_BAD-02      -
F7GVS7_BAD-02          -
A0A2K6E7J3_BAD-02      -
A0A2K5E6K7_BAD-02      -
A0A2K6TG62_BAD-02      -
A0A2K5E6K7_BAD-03      -
A0A2K5HKW9_BAD-02      -
A0A2K6N1A1_BAD-02      -
A0A2K6PUM5_BAD-02      -
A0A2K5M0C1_BAD-03      -
A0A2K5VCD8_BAD-03      -
F7GVS7_BAD-03          -
A0A2K5XJR2_BAD-03      -
A0A2I3MCN5_BAD-02      -
A0A2K6E7J3_BAD-03      -
A0A2I2Z8C7_BAD-04      -
Q92934_BAD-04          -
A0A2I3TBK7_BAD-03      -
A0A2R8Z697_BAD-03      -
F6SJL0_BAD-02          -
A0A2K6TG62_BAD-03      -
G1P8C5_BAD-01          -
W5P8G9_BAD-01          -
G3VRY4_BAD-02          -
G3VRY4_BAD-01          -
I3MBM5_BAD-02          -
I3MBM5_BAD-01          -
Q61337_BAD-03          -
Q61337_BAD-01          -
Q61337_BAD-02          -
G3TP47_BAD-01          -
F7DN67_BAD-01          -
G1MI17_BAD-01          -
A0A287AEF3_BAD-01      -
O35147_BAD-01          -
M3YNE7_BAD-01          -
F1MUT9_BAD-01          -
Q3SYZ0_BAD-01          -
H0WVR2_BAD-01          -
H0V608_BAD-01          -
A0A2K5E6K7_BAD-01      -
A0A2K6TG62_BAD-01      -
A0A0D9R491_BAD-01      -
A0A2K5M0C1_BAD-01      -
A0A2K5VCD8_BAD-01      -
F7GVS7_BAD-01          -
A0A2K6E7J3_BAD-01      -
A0A2K5XJR2_BAD-01      -
A0A2I3MCN5_BAD-04      -
A0A2K6N1A1_BAD-01      -
A0A2K6PUM5_BAD-01      -
A0A2K5HKW9_BAD-01      -
B4DZQ9_BAD-01          -
A0A2K6GWV0_BAD-01      -
F6SJL0_BAD-01          -
A0A2I3MCN5_BAD-01      -
A0A2I2Z8C7_BAD-02      -
A0A2I2Z8C7_BAD-01      -
Q92934_BAD-01          -
Q92934_BAD-02          -
A0A2I3TBK7_BAD-02      -
A0A2R8Z697_BAD-01      -
A0A2J8TYJ3_BAD-01      -
F1PK10_BAD-01          -
Q45KI9_BAD-01          -
                        

© 1998-2019