Dataset for protein classical BH3-containing proteins of organism Xiphophorus maculatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A3B5QAM1_BCL2L11      ------MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRA
A0A3B5QAM1_BCL2L11      MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRA
A0A3B5Q2N7_BAD-01       ---------------MDTKFTISDGESDPSE-------------DVEERG
A0A3B5QK08_BMF-01       ---------------------MEDEEDDVFEPDPNCWRTPFREIKCEDRG
A0A3B5QK08_BMF-02       ---------------------MEDEEDDVFEPDPNCWRTPFREIKCEDRG
                                                                          

A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A3B5QAM1_BCL2L11      PQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPASLDVFRSRSIFRPPR
A0A3B5QAM1_BCL2L11      PQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPASLDVFRSRSIFRPPR
A0A3B5Q2N7_BAD-01       DLQLMQEKEKPLSQRHTLTLPELRSTTGRVRLNSESIAS----------T
A0A3B5QK08_BMF-01       -----TQTPGPGQALHNGMLPCGVVEEPR-RLFYGNAGF----------R
A0A3B5QK08_BMF-02       -----TQTPGPGQALHNGMLPCGVVEEPR-RLFYGNAGF----------R
                                                                          

A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A3B5QAM1_BCL2L11      RSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVE
A0A3B5QAM1_BCL2L11      RSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVE
A0A3B5Q2N7_BAD-01       ISREVELQARGEEEVGTPTEGFPFRGRSLSAPPSLW--------------
A0A3B5QK08_BMF-01       LHFPAHFELVGDFDARQQEEQNRMEQLPLHQPAALS--------------
A0A3B5QK08_BMF-02       LHFPAHFELVGDFDARQQEEQNRMEQLPLHQPAALS--------------
                                                                          

A0A3B5RFA9_PMAIP1-      --------------------LPAAAELCARELRQVGDK------------
A0A3B5QAM1_BCL2L11      HGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMAR
A0A3B5QAM1_BCL2L11      HGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMAR
A0A3B5Q2N7_BAD-01       -----------------------AAKKYGRQLRRMSDEFVNLLD-----K
A0A3B5QK08_BMF-01       -----------------------LEASIGQKLQLIGDQFHREHL-----Q
A0A3B5QK08_BMF-02       -----------------------LEASIGQKLQLIGDQFHREHL-----Q
                                                    ..:*. :.*:            

A0A3B5RFA9_PMAIP1-      -------------------LYWRYKLLEMLL------------KNYETLN
A0A3B5QAM1_BCL2L11      GHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV
A0A3B5QAM1_BCL2L11      GHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV
A0A3B5Q2N7_BAD-01       GEMRNVSSDGSNRPIHHSRSWW-------SYLFSHQETEGENNHHENHAS
A0A3B5QK08_BMF-01       QYQQNQRNQGP--------LWWRMTAALLSLLFDRGFIAGGGGAGRR---
A0A3B5QK08_BMF-02       QYQQNQRNQGP--------LWWRMTAALLSLLFDRGFIAGGGGAGRR---
                                                                          

A0A3B5RFA9_PMAIP1-      KIK
A0A3B5QAM1_BCL2L11      ---
A0A3B5QAM1_BCL2L11      ---
A0A3B5Q2N7_BAD-01       RTE
A0A3B5QK08_BMF-01       ---
A0A3B5QK08_BMF-02       ---
                           

© 1998-2019