Dataset for protein Bim of organism Xiphophorus maculatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5QAM1_BCL2L11      ------MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRA
A0A3B5QAM1_BCL2L11      MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRA
                                * ****************************************

A0A3B5QAM1_BCL2L11      PQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPASLDVFRSRSIFRPPR
A0A3B5QAM1_BCL2L11      PQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPASLDVFRSRSIFRPPR
                        **************************************************

A0A3B5QAM1_BCL2L11      RSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVE
A0A3B5QAM1_BCL2L11      RSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVE
                        **************************************************

A0A3B5QAM1_BCL2L11      HGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMAR
A0A3B5QAM1_BCL2L11      HGGLGLHGQSPNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMAR
                        **************************************************

A0A3B5QAM1_BCL2L11      GHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV
A0A3B5QAM1_BCL2L11      GHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV
                        **************************************************

© 1998-2019