Dataset for protein classical BH3-containing proteins of organism Xiphophorus couchianus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5L9R9_BAD-01       --------MDTKFTISDGESDPSEDVEERGDLQLMQEKEKPLSQRHTLTL
A0A3B5M375_BCL2L11      MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRA
                                 :   .: **.:: :      **      . .. .:      

A0A3B5L9R9_BAD-01       PELRSTKVELQARGEEE--VGTPTEGFP-----------FRGRSLSAP--
A0A3B5M375_BCL2L11      PQAGASTAGGGGGGEGEGRRGEPDSDSPPCSVSPASLDVFRSRSIFRPTR
                        *:  ::..   . ** *   * * .. *           **.**:  *  

A0A3B5L9R9_BAD-01       --------------------------------PSLWAAKKYGRQLRRMSD
A0A3B5M375_BCL2L11      RSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSL-TGQVMNHALQRMAV
                                                        *** :.:  .. *.**: 

A0A3B5L9R9_BAD-01       EFVNLLDKGEMRNVSSDGSNR-------------------------PIHH
A0A3B5M375_BCL2L11      EHGGLGLQGEQTSVLPPPPSETSTTWEQIAVNIGPVLFIRPIPMLVPIYH
                        *. .*  :**  .* .  ..                          **:*

A0A3B5L9R9_BAD-01       SRSWWSYLFSHQETEGENNHHENHASRTE
A0A3B5M375_BCL2L11      ASTL-------------------RISALE
                        : :                    . *  *

© 1998-2019