Dataset for protein classical BH3-containing proteins of organism Xenopus tropicalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6Z067_BAD-01          -----MADSSPSAVFKLEEFDNEEQGLPLP--------FVDPPRGAGVRQ
F6TGJ4_BMF-01          QESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFP
Q4KMV9_BCL2L11-01      -------MAKQPSVLSPDCNSGEGGQLQST-------------SRQHSHR
                                    *:  :  .     :  .                    

F6Z067_BAD-01          PVAKSSPSLRR--YPGKESRLRTESASESSETDKVGELHPFRSRSRSAPS
F6TGJ4_BMF-01          LSHCCGPGCRGADYEDKATQTLGSPSISQ---------------DIMLPC
Q4KMV9_BCL2L11-01      PLRRGAPTSLSSPFQGNQSDEGGSSSASTPWGPTISPYSPSSFVNRSPHC
                            .*      : .: :    ..: .                .    .

F6Z067_BAD-01          SMIAT---------------------------------------------
F6TGJ4_BMF-01          GVSETPQRLFYGHAGYLLYLPQNSPARFGEEVD-----------------
Q4KMV9_BCL2L11-01      MLVRGSSLVSKTSSGYFSFEVSPGPVSCDKSTQTPSPPCQAFNHLLSAMA
                        :                                                

F6Z067_BAD-01          ------------KYGRELRRMSDEFEKSFT-------GLPRPKSASAAGQ
F6TGJ4_BMF-01          --NRRQEQSAEHRIARKLQCIGDQFHRF---------HLQRLQQNRNQFW
Q4KMV9_BCL2L11-01      DRNPVNQMSPELWIAQELRRIGDDFNASFSPRRGIFNNLPRPLDNDQVII
                                   . ..:*. :.*:*             * *  .      

F6Z067_BAD-01          MTGNRSIRDLIMGLFSRRKSKGRDESGDEE
F6TGJ4_BMF-01          SQILIFFRNLVMHPVGNRAGLAQR------
Q4KMV9_BCL2L11-01      LRVLRFIIRLILRL----------------
                             :  *::                  

© 1998-2018