Dataset for protein classical BH3-containing proteins of organism Ursus maritimus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A384D070_BMF-01       MEPPQCVEELEDDVFQPEDGEPGTQPGSL-LSADLFAQSQLDCPLSRLHL
A0A384DJL2_BAD-01       --------MFQIPEFEPSEQ-EDSSPADRGL-------------------
A0A452V3L2_BIK-01       -------MAWSSEEARSREEMSHTGPLSRNLFLSTFLQEHGPEVLEVPGM
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452U4S4_BCL2L11      --------------------------------------------------
                                                                          

A0A384D070_BMF-01       FPLTHCCGPGLRPTSQEDKATQ--------TLSPASPSQGVMLPCGVTEE
A0A384DJL2_BAD-01       ---------GPSPTGDQPPGPGKH------RQTAPGLLGEAAHPQGQPAS
A0A452V3L2_BIK-01       TDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452U4S4_BCL2L11      ----------------------------------------------MAKQ
                                                                          

A0A384D070_BMF-01       PQRLFYGNAGYRLPL-----PASFPAGLPLGEQ----------------P
A0A384DJL2_BAD-01       S-----NHHGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFRGRSSSAP
A0A452V3L2_BIK-01       SLAFTYNQTGLRGVL-----RSLMDGLTNLRENIRIWSFLTFRNRGLDLE
A0A452TE71_PMAIP1-      -----------WGSLLSGEPASPSPSAAP--------------------P
A0A452U4S4_BCL2L11      PSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRS---------P
                                      :      .                            

A0A384D070_BMF-01       PEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRV-----------
A0A384DJL2_BAD-01       PNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQ
A0A452V3L2_BIK-01       PS------------------------LPATQPQSRSSRCSDSPPPAGLVR
A0A452TE71_PMAIP1-      PEVECAIQ------------------LRRFGDKLNFRQKLLN-----LIS
A0A452U4S4_BCL2L11      APMSCDKS------------------TQTPSPPCQAFNHYLSAMDLWTVE
                        .                                    .            

A0A384D070_BMF-01       -WWQILLFLHNLALNADENRDGAGPR-
A0A384DJL2_BAD-01       SWWDRNL-----------GRGGSAPSQ
A0A452V3L2_BIK-01       S---CPL-----------PAAPSGPHD
A0A452TE71_PMAIP1-      KLFRSGT--------------------
A0A452U4S4_BCL2L11      RHLETAL--------------------
                                                   

© 1998-2019