Dataset for protein classical BH3-containing proteins of organism Ursus americanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452STA4_PMAIP1-      -------------MPGKKARKSAQASPARTPAE-----------------
A0A452SED0_BMF-01       MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLF
A0A452SBG5_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRS
A0A452QUG1_BIK-01       ----------FHTTRRCAQRVVAPSLHHQHPAGEG---------------
A0A452RJM6_BAD-01       MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAQ
                                              .       ..                  

A0A452STA4_PMAIP1-      --------------------------------------------------
A0A452SED0_BMF-01       PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A452SBG5_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQDV--------------
A0A452QUG1_BIK-01       -------AVLTGAGGICQATGPLCNNPDDVAMRLAFIGDEMEVRWMLPRV
A0A452RJM6_BAD-01       PQGQPASSNHHGGAGAVEPRSRHSSYPAGTEEDEGL--EEEELSPFRGRS
                                                                          

A0A452STA4_PMAIP1-      ----------------------------PEVECAIQLRRFGDKLNFRQ--
A0A452SED0_BMF-01       GYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLH--
A0A452SBG5_BCL2L11      -----------------------PADMRPEIWIAQELRRIGDEFNAYY--
A0A452QUG1_BIK-01       G--------------------ELPGMAMYSLAFTYN--------QTGLRG
A0A452RJM6_BAD-01       S--------------------SAPPNLCAALRYGRELRRMSDEFQGSFKG
                                                      :    :        :     

A0A452STA4_PMAIP1-      -------------------------------------KLLNLISKLFRSG
A0A452SED0_BMF-01       ------------------------MQQHQQNQNRVWWQILLFLHNLALNA
A0A452SBG5_BCL2L11      ----------------PRRVFLNNYQAAEAHPQMIILRLLRYIIRLV--W
A0A452QUG1_BIK-01       VLRSLMDGLTNLRENIRIWSFLTFRNRVSPHPGRRLVLSLLLLLGLLLGW
A0A452RJM6_BAD-01       LPRPKSAGTATQMRQSPSWT------------------------RVIQSW
                                                                     :    

A0A452STA4_PMAIP1-      T-------------
A0A452SED0_BMF-01       DENRDGAGPR----
A0A452SBG5_BCL2L11      RLQ-----------
A0A452QUG1_BIK-01       GFRLLQ--------
A0A452RJM6_BAD-01       WDRNLGRGGSAPSQ
                                      

© 1998-2019