Dataset for protein classical BH3-containing proteins of organism Tarsius syrichta

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7T0R1_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
                        *****************************************         

A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A1U7T0R1_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A1U7T0R1_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A1U7T0R1_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A1U7T0R1_BCL2L11      EGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
                                                                          

A0A1U7T0R1_BCL2L11      -------------------------------ESMRQSQAEPPDMRPEIWI
A0A1U7T0R1_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMESMRQSQAEPPDMRPEIWI
A0A1U7T0R1_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GLFE----------
A0A1U7T0R1_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A1U7T0R1_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMESMRQSQAEPPDMRPEIWI
A0A1U7T0R1_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMESMRQSQAEPPDMRPEIWI
                                                                          

A0A1U7T0R1_BCL2L11      AQELRRIGDEFNAYYPRRLAKNLASSS-----------------------
A0A1U7T0R1_BCL2L11      AQELRRIGDEFNAYYPRRAYLNNNQAAEDHPQMVLLRLLRYIVRLVWRMY
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      --------------------------------------------------
A0A1U7T0R1_BCL2L11      AQELRRIGDEFNAYYPRRMPFPPD--------------------------
A0A1U7T0R1_BCL2L11      AQELRRIGDEFNAYYPRRLEK-----------------------------
                                                                          

© 1998-2019