Dataset for protein classical BH3-containing proteins of organism Tarsius syrichta

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7SU38_BCL2L11      MAKQPSVVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGSPGG
A0A1U7UD37_BMF-02       --MDPSQCVEELEDD--VFQPEDGESGTQSGSLLSADLFAQSQLD-----
A0A1U7UD37_BMF-01       --MDPSQCVEELEDD--VFQPEDGESGTQSGSLLSADLFAQSQLD-----
                           :**   .* : :   :** :  .  ..*:  * :  .*         

A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      EGDRCPHGSPQG-PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A1U7SU38_BCL2L11      EGDRCPHGSPQG-PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A1U7SU38_BCL2L11      EGDRCPHGSPQG-PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A1U7SU38_BCL2L11      EGDRCPHGSPQG-PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A1U7SU38_BCL2L11      EGDRCPHGSPQG-PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSF
A0A1U7UD37_BMF-02       ----CPLSRLQLFPLTHCCGPGLRHTSQE---------------------
A0A1U7UD37_BMF-01       ----CPLSRLQLFPLTHCCGPGLRHTSQE---------------------
                                                                          

A0A1U7SU38_BCL2L11      --------------------------------------------------
A0A1U7SU38_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7SU38_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7SU38_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7SU38_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7SU38_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7SU38_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQA------------------FNHYLSAM
A0A1U7UD37_BMF-02       --DKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSHVVAD
A0A1U7UD37_BMF-01       --DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGL
                                                                          

A0A1U7SU38_BCL2L11      ESMRQSQAEPPDMRPEIWIAQELRRIGDEFNAYYPRRLAKNLASSS----
A0A1U7SU38_BCL2L11      ESMRQSQAEPPDMRPEIWIAQELRRIGDEFNAYYPRRAYLNNNQAAEDHP
A0A1U7SU38_BCL2L11      ESMRQSQAEPPDMRPEIWIAQELRRIGDEFNAYYPRRAYLNNNQAAEDHP
A0A1U7SU38_BCL2L11      -----GLFE-----------------------------------------
A0A1U7SU38_BCL2L11      VREIEEVVV-----------------------------------------
A0A1U7SU38_BCL2L11      ESMRQSQAEPPDMRPEIWIAQELRRIGDEFNAYYPRRMPFPPD-------
A0A1U7SU38_BCL2L11      ESMRQSQAEPPDMRPEIWIAQELRRIGDEFNAYYPRRLEK----------
A0A1U7UD37_BMF-02       TLLPTQPRFEW-------------------------RREQERGRS-----
A0A1U7UD37_BMF-01       PFGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMWWQIL
                                                                          

A0A1U7SU38_BCL2L11      --------------------
A0A1U7SU38_BCL2L11      QMVLLRLLRYIVRLVWRMY-
A0A1U7SU38_BCL2L11      QMVLLRLLRYIVRLVWRMY-
A0A1U7SU38_BCL2L11      --------------------
A0A1U7SU38_BCL2L11      --------------------
A0A1U7SU38_BCL2L11      --------------------
A0A1U7SU38_BCL2L11      --------------------
A0A1U7UD37_BMF-02       --------------------
A0A1U7UD37_BMF-01       FFLHNLALNGEENRNGAGPR
                                            

© 1998-2018