Dataset for protein Bmf of organism Tarsius syrichta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7UD37_BMF-02      MDPSQCVEELEDDVFQPEDGESGTQSGSLLSADLFAQSQLDCPLSRLQLF
A0A1U7UD37_BMF-01      MDPSQCVEELEDDVFQPEDGESGTQSGSLLSADLFAQSQLDCPLSRLQLF
                       **************************************************

A0A1U7UD37_BMF-02      PLTHCCGPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
A0A1U7UD37_BMF-01      PLTHCCGPGLRHTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
                       ***********************************************. *

A0A1U7UD37_BMF-02      E-----PKSHVVADTLLPTQPRFEW-------------------------
A0A1U7UD37_BMF-01      GYRLPLPASFPAGLPFGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                             * *. .. .:    *  :*                         

A0A1U7UD37_BMF-02      RREQERGRS-------------------------
A0A1U7UD37_BMF-01      QHQQNRNRMWWQILFFLHNLALNGEENRNGAGPR
                       ..:*:*.*                          

© 1998-2018