Dataset for protein classical BH3-containing proteins of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5K831_BAD-01      MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTG
A0A3B5KWG6_BMF-01      --------MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSG
                                *.:.*   : *  ...:::.* : :    :*   .    :*

A0A3B5K831_BAD-01      TSRTRVSSESQASTFSREEELQGNVEDEAGTPTEGAPFRGRSRSAPPALW
A0A3B5KWG6_BMF-01      MLPCGVAEEPRLLFYGEAGD---TLHYTGGAPNGMEPL---PQQGPVVRS
                            *:.*..   :.   :   .:   .*:*.   *:   ....* .  

A0A3B5K831_BAD-01      AAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWW------
A0A3B5KWG6_BMF-01      TEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPL--------WWRLGTAL
                       :    *.:*. :.*:*     :   *: .. *.         **      

A0A3B5K831_BAD-01      -SYLFSHQETEGENGHHDGHTHRTE
A0A3B5KWG6_BMF-01      LSLLFDRGFVAGGGGAGRR------
                        * **..  . * .*          

© 1998-2019