Dataset for protein Noxa of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AZR7_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGS
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        -----ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGA
Q9GL49_PMAIP1-01        FGPPPAAVRGNQPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGA
                                                                          

A0A287AZR7_PMAIP1-      ----LSKETFMAKGKVLFASMPHRSSNKNTQTNPLRLALPPLPAVKCRIG
F1SMU1_PMAIP1-01        RVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQ
Q9GL49_PMAIP1-01        RVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQ
                            **. :* ** .:***.** * *..****** *:**** * *:* * 

A0A287AZR7_PMAIP1-      LRRVGTKLAIRQQITNFIIFFFFLGP
F1SMU1_PMAIP1-01        FRRIGDKLNFRQKLLNLIAKLFRLGT
Q9GL49_PMAIP1-01        FRRIGDKLNFRQKLLNLIAKLFRLGT
                        :**:* ** :**:: *:*  :* **.

© 1998-2018