Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AZR7_PMAIP1-      ----------------LSKETFMAKG------------------------
A0A287AEF3_BAD-02       MFQIPEFEQSEQEDSSPADRGLGPSP------------------------
F1SMU1_PMAIP1-01        ---------ARAAAGAPTSEAFGRSG------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
A0A287AEF3_BAD-01       MGIPENPSSASTHTQGIRKSGAEPGT-------------PEEGGGRGRSR
Q9GL49_PMAIP1-01        -------MRSSGSLGSRIRGLLESAG-------------WEELVRSQPRA
F1RM01_BBC3-01          MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A287AIU8_BMF-05       -------MEPPQCVEELEDDVFQPEE-------------GEPGTQPRRVS
A0A287AIU8_BMF-03       -------MEPPQCVEELEDDVFQPEE-------------GEPGTQPRRVS
A0A287AIU8_BMF-01       -------MEPPQCVEELEDDVFQPEE-------------GEPGTQPRRVS
A0A287AIU8_BMF-02       -------MEPPQCVEELEDDVFQPEE-------------GEPGTQPRRVS
A0A287AIU8_BMF-04       -------MEPPQCVEELEDDVFQPEE-------------GEPGTQPRRVS
F1SU81_BCL2L11-01       -----MAKQPSDVSSECDREGGQLQP-------------AERPPQLRPGA
F1SU81_BCL2L11-02       -----MAKQPSDVSSECDREGGQLQP-------------AERPPQLRPGA
C1KGB8_BCL2L11-01       -----MAKQPSDVSSECDREGGQLQP-------------AERPPQLRPGA
F1SU81_BCL2L11-03       -----MAKQPSDVSSECDREGGQLQP-------------AERPPQLRPGA
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A287A5N9_HRK-01       -------MCPCPLHR-----------------------------------
A0A287AEF3_BAD-01       SGPASQSMFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQPW---------
Q9GL49_PMAIP1-01        HQGLTSGR--CGQTRREELRGSFGPPPAAVRGNQPTSEA-----------
F1RM01_BBC3-01          PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP----------
A0A287AIU8_BMF-05       ADPFVQSQLDCPLSRLQLFPL----THCCGPGLRPTSQE-----------
A0A287AIU8_BMF-03       ADPFVQSQLDCPLSRLQLFPL----THCCGPGLRPTSQE-----------
A0A287AIU8_BMF-01       ADPFVQSQLDCPLSRLQLFPL----THCCGPGLRPTSQE-----------
A0A287AIU8_BMF-02       ADPFVQSQLDCPLSRLQLFPL----THCCGPGLRPTSQE-----------
A0A287AIU8_BMF-04       ADPFVQSQLDCPLSRLQLFPL----THCCGPGLRPTSQE-----------
F1SU81_BCL2L11-01       PTSLQTERQGNPEGEGDRCPQ----GSPQGPLAPPTSPGPFATRSPLFIF
F1SU81_BCL2L11-02       PTSLQTERQGNPEGEGDRCPQ----GSPQGPLAPPTSPGPFATRSPLFIF
C1KGB8_BCL2L11-01       PTSLQTERQ-----------------------------------------
F1SU81_BCL2L11-03       PTSLQTERQ-----------------------------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
A0A287AEF3_BAD-02       -----------------TGTDPQAPASPGARPQATW----GKLVTSRGSR
F1SMU1_PMAIP1-01        --------------CCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSR
A0A287A5N9_HRK-01       -------------------GRGPPAVCACSASRLGLRSS-----------
A0A287AEF3_BAD-01       -------------------RTAPGHLGEAGHQQGQPASSS----------
Q9GL49_PMAIP1-01        ---------FGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSR
F1RM01_BBC3-01          -------------------DGPQPSLSPAEQHLESPVPSA----------
A0A287AIU8_BMF-05       -------------------DKATQTLSPASPSQGVMLPCG---VTEEPQR
A0A287AIU8_BMF-03       -------------------DKATQTLSPASPSQGVMLPCG---VTEEPQR
A0A287AIU8_BMF-01       -------------------DKATQTLSPASPSQGVMLPCG---VTEEPQR
A0A287AIU8_BMF-02       -------------------DKATQTLSPASPSQGVMLPCG---VTEEPQR
A0A287AIU8_BMF-04       -------------------DKATQTLSPASPSQGVMLPCG---VTEEPQR
F1SU81_BCL2L11-01       VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---AFNH---
F1SU81_BCL2L11-02       VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ---AFNH---
C1KGB8_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-03       -------------------DRSPAPMSCDKSTQTPSPPCQ---AFNH---
                                                                          

A0A287AZR7_PMAIP1-      ---------------------KVLFASMPHRSSNKNTQTNPLRLALPPL-
A0A287AEF3_BAD-02       PAAATMEALGLWRPGVATALTQRGPRRMKGLRMRSSAPSAADRSRRPPS-
F1SMU1_PMAIP1-01        SFAAKFRLL---------------FAEMPGRRSRRNTQTNPTRVALPPD-
A0A287A5N9_HRK-01       --------------------------------------------------
A0A287AEF3_BAD-01       ---HHGGAG---------------AVETRSRHSSYPEGTEEDEGTEDEEL
Q9GL49_PMAIP1-01        SFAAKFRLL---------------FAEMPGRRSRRNTQTNPTRVALPPD-
F1RM01_BBC3-01          ----------------------------PGALAGGPTQAAPGIRGEEEQ-
A0A287AIU8_BMF-05       LFYGNAGYR---------------LPLPAGFPAGLPLGEQPPEGQWQHR-
A0A287AIU8_BMF-03       LFYGNAGYR---------------LPLPAGFPAGLPLGEQPPEGQWQHR-
A0A287AIU8_BMF-01       LFYGNAGYR---------------LPLPAGFPAGLPLGEQPPEGQWQHR-
A0A287AIU8_BMF-02       LFYGNAGYR---------------LPLPAGFPAGLPLGEQPPEGQWQHR-
A0A287AIU8_BMF-04       LFYGNAGYR---------------LPLPAGFPAGLPLGEQPPEGQWQHR-
F1SU81_BCL2L11-01       ------------------------------YLSAMASMRQSQAEPADMR-
F1SU81_BCL2L11-02       ------------------------------YLSAMASMRQSQAEPADMR-
C1KGB8_BCL2L11-01       -----------------------------------ASMRQSQAEPADMR-
F1SU81_BCL2L11-03       ------------------------------YLSAMASMRQSQAEPADMR-
                                                                          

A0A287AZR7_PMAIP1-      ---------------PAVKCRIGLRRVGTKLAI-----RQQITNFIIFFF
A0A287AEF3_BAD-02       ---------------SGLHSVMAASSGG----------------------
F1SMU1_PMAIP1-01        ---------------PEVECAIQFRRIGDKLNF-----RQKLLNLIAKLF
A0A287A5N9_HRK-01       ---------------AAQLTAARLKALGDELHQRT---MWRRSARSRRAP
A0A287AEF3_BAD-01       SPFRGRSLSAPPILWAAQRYGRELRRMSDEFQGSFKGLPRPKSAGTATQM
Q9GL49_PMAIP1-01        ---------------PEVECAIQFRRIGDKLN--F---RQKLLNLIAKLF
F1RM01_BBC3-01          ---------------WAREIGAQLRRMADDLNALY---ERRRQEEQQRHR
A0A287AIU8_BMF-05       ---------------AEVQIARKLQCIADQFHRLH---MQQEFPS----W
A0A287AIU8_BMF-03       ---------------AEVQIARKLQCIADQFHRLH---MQQHQQNQNRVW
A0A287AIU8_BMF-01       ---------------AEVQIARKLQCIADQFHRLH---MQQHQQNQNRVW
A0A287AIU8_BMF-02       ---------------AEVQIARKLQCIADQFHRLH---MQQHQQNQNRVW
A0A287AIU8_BMF-04       ---------------AEVQIARKLQCIADQFHRLH---MQQHQQNQNRVW
F1SU81_BCL2L11-01       ---------------PEIWIAQELRRIGDEFNAYY---PRRVFLNNYQAA
F1SU81_BCL2L11-02       ---------------PEIWIAQELRRIGDEFNAYY---PRRVMLFSLPPF
C1KGB8_BCL2L11-01       ---------------PEIWIAQELRRIGDEFNAYY---PRRVMLFSLPPF
F1SU81_BCL2L11-03       ---------------PEIWIAQELRRIGDEFNAYY---PRRVMLFSLPPF
                                                   .                      

A0A287AZR7_PMAIP1-      FLGP---------------------------
A0A287AEF3_BAD-02       -------------------------------
F1SMU1_PMAIP1-01        RLGT---------------------------
A0A287A5N9_HRK-01       APGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A287AEF3_BAD-01       RQSPSWKRFLQSWWYRNSGRGGPAPSQ----
Q9GL49_PMAIP1-01        RLGT---------------------------
F1RM01_BBC3-01          PSPWRVLYNLIMGLLPLPRGRGAPEMEPN--
A0A287AIU8_BMF-05       LG-----------------------------
A0A287AIU8_BMF-03       WQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-01       WQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-02       WQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-04       WQILLFLHNLALHGDENRNGAGPR-------
F1SU81_BCL2L11-01       EAH---PQMVILRLLRYIARLVWRMQ-----
F1SU81_BCL2L11-02       SPHTLPPPYI---------------------
C1KGB8_BCL2L11-01       SPHTLPPPYI---------------------
F1SU81_BCL2L11-03       SPHTLPPPYI---------------------
                                                       

© 1998-2018