Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AZR7_PMAIP1-      --------------------------------------------------
A0A287AEF3_BAD-02       --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A287A5N9_HRK-01       --------------------------------------------------
A0A287AEF3_BAD-01       ------------------MGIPENPSSASTHTQGIRKSGAEPGT------
Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRR------
F1RM01_BBC3-01          ------------------MARARQEGSSPEPVEGLARDGPRPFPLSRLVP
A0A287AIU8_BMF-05       -------------------------MEPPQCVEELEDDVFQPEE------
A0A287AIU8_BMF-01       -------------------------MEPPQCVEELEDDVFQPEE------
A0A287AIU8_BMF-04       -------------------------MEPPQCVEELEDDVFQPEE------
A0A287AIU8_BMF-03       -------------------------MEPPQCVEELEDDVFQPEE------
A0A287AIU8_BMF-02       -------------------------MEPPQCVEELEDDVFQPEE------
F1SU81_BCL2L11-01       -----------------------MAKQPSDVSSECDREGGQLQP------
F1SU81_BCL2L11-02       -----------------------MAKQPSDVSSECDREGGQLQP------
C1KGB8_BCL2L11-01       -----------------------MAKQPSDVSSECDREGGQLQP------
F1SU81_BCL2L11-03       -----------------------MAKQPSDVSSECDREGGQLQP------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
A0A287AEF3_BAD-02       --MFQIPEFEQSEQEDSSPADRGLGPSP---TG-----------------
F1SMU1_PMAIP1-01        -----------ARAAAGAPTSEAFGRSGCCFSS-----------------
A0A287A5N9_HRK-01       -------------------------MCPCPLHR-----------------
A0A287AEF3_BAD-01       -------PEEGGGRGRSRSGPASQSMFQIPEFEQSEQEDSSPADRGLGPS
Q9GL49_PMAIP1-01        EELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSS-----------------
F1RM01_BBC3-01          SAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGGPR
A0A287AIU8_BMF-05       -------GEPGTQPRRVSADPFVQSQLDCPLSRLQLFPL----THCCGPG
A0A287AIU8_BMF-01       -------GEPGTQPRRVSADPFVQSQLDCPLSRLQLFPL----THCCGPG
A0A287AIU8_BMF-04       -------GEPGTQPRRVSADPFVQSQLDCPLSRLQLFPL----THCCGPG
A0A287AIU8_BMF-03       -------GEPGTQPRRVSADPFVQSQLDCPLSRLQLFPL----THCCGPG
A0A287AIU8_BMF-02       -------GEPGTQPRRVSADPFVQSQLDCPLSRLQLFPL----THCCGPG
F1SU81_BCL2L11-01       -------AERPPQLRPGAPTSLQTERQGNPEGEGDRCPQ----GSPQGPL
F1SU81_BCL2L11-02       -------AERPPQLRPGAPTSLQTERQGNPEGEGDRCPQ----GSPQGPL
C1KGB8_BCL2L11-01       -------AERPPQLRPGAPTSLQTERQ-----------------------
F1SU81_BCL2L11-03       -------AERPPQLRPGAPTSLQTERQ-----------------------
                                                                          

A0A287AZR7_PMAIP1-      --------------------------------------------------
A0A287AEF3_BAD-02       -------------------------------------TDPQAPASPGARP
F1SMU1_PMAIP1-01        -------------------------------------SLPLARFCPTAPR
A0A287A5N9_HRK-01       -------------------------------------GRGPPAVCACSAS
A0A287AEF3_BAD-01       PTGTDPQPW----------------------------RTAPGHLGEAGHQ
Q9GL49_PMAIP1-01        -------------------------------------SLPLARFCPTAPR
F1RM01_BBC3-01          SRPRGPRP-----------------------------DGPQPSLSPAEQH
A0A287AIU8_BMF-05       LRPTSQE------------------------------DKATQTLSPASPS
A0A287AIU8_BMF-01       LRPTSQE------------------------------DKATQTLSPASPS
A0A287AIU8_BMF-04       LRPTSQE------------------------------DKATQTLSPASPS
A0A287AIU8_BMF-03       LRPTSQE------------------------------DKATQTLSPASPS
A0A287AIU8_BMF-02       LRPTSQE------------------------------DKATQTLSPASPS
F1SU81_BCL2L11-01       APPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
F1SU81_BCL2L11-02       APPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKST
C1KGB8_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-03       -------------------------------------DRSPAPMSCDKST
                                                                          

A0A287AZR7_PMAIP1-      --------------LSKETFMAKGKVL---------------FASMPHRS
A0A287AEF3_BAD-02       QATW----GKLVTSRGSRPAAATMEALGLWRPGVATALTQRGPRRMKGLR
F1SMU1_PMAIP1-01        AACYLQSQGARVRGLSSRSFAAKFRLL---------------FAEMPGRR
A0A287A5N9_HRK-01       RLGLRSS-------------------------------------------
A0A287AEF3_BAD-01       QGQPASSS-------------HHGGAG---------------AVETRSRH
Q9GL49_PMAIP1-01        AACYLQSQGARVRGLSSRSFAAKFRLL---------------FAEMPGRR
F1RM01_BBC3-01          LESPVPSA--------------------------------------PGAL
A0A287AIU8_BMF-05       QGVMLPCG---VTEEPQRLFYGNAGYR---------------LPLPAGFP
A0A287AIU8_BMF-01       QGVMLPCG---VTEEPQRLFYGNAGYR---------------LPLPAGFP
A0A287AIU8_BMF-04       QGVMLPCG---VTEEPQRLFYGNAGYR---------------LPLPAGFP
A0A287AIU8_BMF-03       QGVMLPCG---VTEEPQRLFYGNAGYR---------------LPLPAGFP
A0A287AIU8_BMF-02       QGVMLPCG---VTEEPQRLFYGNAGYR---------------LPLPAGFP
F1SU81_BCL2L11-01       QTPSPPCQ---AFNH---------------------------------YL
F1SU81_BCL2L11-02       QTPSPPCQ---AFNH---------------------------------YL
C1KGB8_BCL2L11-01       --------------------------------------------------
F1SU81_BCL2L11-03       QTPSPPCQ---AFNH---------------------------------YL
                                                                          

A0A287AZR7_PMAIP1-      SNKNTQTNPLRLALPPL----------------PAVKCRIGLRRVGTKLA
A0A287AEF3_BAD-02       MRSSAPSAADRSRRPPS----------------SGLHSVMAASSGG----
F1SMU1_PMAIP1-01        SRRNTQTNPTRVALPPD----------------PEVECAIQFRRIGDKLN
A0A287A5N9_HRK-01       ---------------------------------AAQLTAARLKALGDELH
A0A287AEF3_BAD-01       SSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEFQ
Q9GL49_PMAIP1-01        SRRNTQTNPTRVALPPD----------------PEVECAIQFRRIGDKLN
F1RM01_BBC3-01          AGGPTQAAPGIRGEEEQ----------------WAREIGAQLRRMADDLN
A0A287AIU8_BMF-05       AGLPLGEQPPEGQWQHR----------------AEVQIARKLQCIADQFH
A0A287AIU8_BMF-01       AGLPLGEQPPEGQWQHR----------------AEVQIARKLQCIADQFH
A0A287AIU8_BMF-04       AGLPLGEQPPEGQWQHR----------------AEVQIARKLQCIADQFH
A0A287AIU8_BMF-03       AGLPLGEQPPEGQWQHR----------------AEVQIARKLQCIADQFH
A0A287AIU8_BMF-02       AGLPLGEQPPEGQWQHR----------------AEVQIARKLQCIADQFH
F1SU81_BCL2L11-01       SAMASMRQSQAEPADMR----------------PEIWIAQELRRIGDEFN
F1SU81_BCL2L11-02       SAMASMRQSQAEPADMR----------------PEIWIAQELRRIGDEFN
C1KGB8_BCL2L11-01       ---ASMRQSQAEPADMR----------------PEIWIAQELRRIGDEFN
F1SU81_BCL2L11-03       SAMASMRQSQAEPADMR----------------PEIWIAQELRRIGDEFN
                                                                     .    

A0A287AZR7_PMAIP1-      I-----RQQITNFIIFFFFLGP---------------------------
A0A287AEF3_BAD-02       -------------------------------------------------
F1SMU1_PMAIP1-01        F-----RQKLLNLIAKLFRLGT---------------------------
A0A287A5N9_HRK-01       QRT---MWRRSARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
A0A287AEF3_BAD-01       GSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ----
Q9GL49_PMAIP1-01        --F---RQKLLNLIAKLFRLGT---------------------------
F1RM01_BBC3-01          ALY---ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN--
A0A287AIU8_BMF-05       RLH---MQQEFPS----WLG-----------------------------
A0A287AIU8_BMF-01       RLH---MQQHQQNQNRVWWQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-04       RLH---MQQHQQNQNRVWWQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-03       RLH---MQQHQQNQNRVWWQILLFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-02       RLH---MQQHQQNQNRVWWQILLFLHNLALHGDENRNGAGPR-------
F1SU81_BCL2L11-01       AYY---PRRVFLNNYQAAEAH---PQMVILRLLRYIARLVWRMQ-----
F1SU81_BCL2L11-02       AYY---PRRVMLFSLPPFSPHTLPPPYI---------------------
C1KGB8_BCL2L11-01       AYY---PRRVMLFSLPPFSPHTLPPPYI---------------------
F1SU81_BCL2L11-03       AYY---PRRVMLFSLPPFSPHTLPPPYI---------------------
                                                                         

© 1998-2019