Dataset for protein Bmf of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AIU8_BMF-05      MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFP
A0A287AIU8_BMF-03      MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFP
A0A287AIU8_BMF-01      MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFP
A0A287AIU8_BMF-02      MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFP
A0A287AIU8_BMF-04      MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFP
                       **************************************************

A0A287AIU8_BMF-05      LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
A0A287AIU8_BMF-03      LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
A0A287AIU8_BMF-01      LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
A0A287AIU8_BMF-02      LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
A0A287AIU8_BMF-04      LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAG
                       **************************************************

A0A287AIU8_BMF-05      YRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
A0A287AIU8_BMF-03      YRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
A0A287AIU8_BMF-01      YRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
A0A287AIU8_BMF-02      YRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
A0A287AIU8_BMF-04      YRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQ
                       **************************************************

A0A287AIU8_BMF-05      EFPS----WLG----------------------
A0A287AIU8_BMF-03      HQQNQNRVWWQILLFLHNLALHGDENRNGAGPR
A0A287AIU8_BMF-01      HQQNQNRVWWQILLFLHNLALHGDENRNGAGPR
A0A287AIU8_BMF-02      HQQNQNRVWWQILLFLHNLALHGDENRNGAGPR
A0A287AIU8_BMF-04      HQQNQNRVWWQILLFLHNLALHGDENRNGAGPR
                          .    *                        

© 1998-2018