Dataset for protein Bim of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1SU81_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
F1SU81_BCL2L11-02      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
C1KGB8_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
F1SU81_BCL2L11-03      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
                       *****************************************         

F1SU81_BCL2L11-01      CPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
F1SU81_BCL2L11-02      CPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
C1KGB8_BCL2L11-01      --------------------------------------------------
F1SU81_BCL2L11-03      -----------------------------------------------DRS
                                                                         

F1SU81_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
F1SU81_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
C1KGB8_BCL2L11-01      ---------------------------ASMRQSQAEPADMRPEIWIAQEL
F1SU81_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
                                                  ***********************

F1SU81_BCL2L11-01      RRIGDEFNAYYPRRVFLNNYQAAEAH---PQMVILRLLRYIARLVWRMQ
F1SU81_BCL2L11-02      RRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI----------------
C1KGB8_BCL2L11-01      RRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI----------------
F1SU81_BCL2L11-03      RRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI----------------
                       ***************:* .  . ..*   *  :                

© 1998-2018