Dataset for protein Bad of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AEF3_BAD-02      --------------------------------------------MFQIPE
A0A287AEF3_BAD-01      MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPE
                                                                   ******

A0A287AEF3_BAD-02      FEQSEQEDSSPADRGLGPSPTGTDPQA-PASPGARPQATWGK----LVTS
A0A287AEF3_BAD-01      FEQSEQEDSSPADRGLGPSPTGTDPQPWRTAPGHLGEAGHQQGQPASSSH
                       **************************.  ::**   :* . :      : 

A0A287AEF3_BAD-02      RGSRPAAATMEALGLWRPGV----ATALTQRGPRRMKGL-----------
A0A287AEF3_BAD-01      HGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQR
                       .*.  *. * .  . :  *.    .*   : .* * ..*           

A0A287AEF3_BAD-02      ------RMRSSAPSAADRSRRPPSSGLHSVMAASS---------------
A0A287AEF3_BAD-01      YGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSG
                             ** ..  .: .   ** *:*  : *  *.               

A0A287AEF3_BAD-02      -GG-----
A0A287AEF3_BAD-01      RGGPAPSQ
                        **     

© 1998-2018