Dataset for protein classical BH3-containing proteins of organism Stegastes partitus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5B8F6_BMF-01      ---------MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNN
A0A3B5BAL2_BAD-01      MAAQFSISGSESDPEEV------------------EEGENNHPPAEQPMH
                                 :.: ::*                  : * :.  ** ** :

A0A3B5B8F6_BMF-01      GMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGDHQARQQQGSEMEQNGM
A0A3B5BAL2_BAD-01      VFERRNLA-LPELRTPAAGRIRLNSESHATTVSRDEELQARGEEEAGTPT
                        :   .:*  *     . . :**:  :.   :.  :  * .*.*   .  

A0A3B5B8F6_BMF-01      EQLP-----RQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGP
A0A3B5BAL2_BAD-01      DGAPFRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMKRVRSAGT
                       :  *     .. * *  .    ****. :.*:*     :   .. *. *.

A0A3B5B8F6_BMF-01      L--------WWRLAAALLSLLFDRGFIAGGGGAGRR------
A0A3B5BAL2_BAD-01      AKQMHHSKSWW-------SYLFSHQELEGENNHHENHTHRNE
                                **       * **..  : * ..   .      

© 1998-2019