Dataset for protein classical BH3-containing proteins of organism Seriola lalandi dorsalis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4XZH1_BCL2L11      MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPGAKPQF
A0A3B4W9T1_BAD-01       --------------------------------------------------
A0A3B4WM88_BMF-01       --------------------------------------------------
                                                                          

A0A3B4XZH1_BCL2L11      ERQRRAETIATSPGNSLGVFQKRSIFSYPRRSSSGYFSFDSDSLPTSPLS
A0A3B4W9T1_BAD-01       ---------------------MAANFTISDSESEPSEEVDEGEMSQSLTG
A0A3B4WM88_BMF-01       ------------------------------MDDEEDDVFEPDPHCWRTTF
                                                       ...    .: .        

A0A3B4XZH1_BCL2L11      PRPATAERTTQTPSPTSQ--------------------------VMKHAL
A0A3B4W9T1_BAD-01       QEQELSQRHTLTL-PELR--------GAATGRTRLNSESHTSTVSRDEEF
A0A3B4WM88_BMF-01       REIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHF
                              :* * *  *                                  :

A0A3B4XZH1_BCL2L11      QRMAEAHGGGARMQQQQHGE---HRHFASGDMQAEAVGQELRRIGDDFNR
A0A3B4W9T1_BAD-01       QARGEEEAGTPTEGAPFRGR---SKSAPPALWAAKKYGQKLRRMSDEFDS
A0A3B4WM88_BMF-01       ELVGDQEARRQGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFH-
                        :  .:  .         .*     .  . .       **:*. :.*:*  

A0A3B4XZH1_BCL2L11      LL---------------LLRVSHHRWCVCVCVCVCACGCVCACGCVCGCV
A0A3B4W9T1_BAD-01       LLDKGEMRKVKSAGTAKQMHHSKSWW-----------------SYLFSHQ
A0A3B4WM88_BMF-01       -------REHLQLYHQNQRNHGPLWWRLAAAL----------LSLLFDRG
                                           . .  .*                 . : .  

A0A3B4XZH1_BCL2L11      RVCGGGGGVE-------
A0A3B4W9T1_BAD-01       ETEGENNHHENHTHRTE
A0A3B4WM88_BMF-01       LIAGGGGAGRR------
                           * ..          

© 1998-2019