Dataset for protein classical BH3-containing proteins of organism Seriola dumerili

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4UNJ0_BMF-01       -------------MDDEEEDM-----SQPISHLWGTSFRDVKYEDRATPI
A0A3B4U5H8_BMF-01       -------------MDDEEDDV-----FEPDPHCWRTTFREIKCEDRGTQT
A0A3B4V919_BCL2L11      -------------MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTT
A0A3B4VFC5_BAD-01       MAANFTISDSESEPSEEVDEGEMSQSLTGQEQELSQRHTLTLPELRGAAT
                                      . : :                        * *.:  

A0A3B4UNJ0_BMF-01       AA-----------GQALTAVTAAPLILF--------------VWWVPHWE
A0A3B4U5H8_BMF-01       PGPALALNN----GMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEA
A0A3B4V919_BCL2L11      RRCRWSPSAKPQFERQRRAEPWPPRLHRRRRARLAAPVQNHSHLSCQHFS
A0A3B4VFC5_BAD-01       GRTRLNS------ESHTSTVSRDEEFQARGEEEAGTPTEGAP--------
                                            .                             

A0A3B4UNJ0_BMF-01       LSPSTKMNMLRFSENRPEEQAGVSVEAQIGRKLREIGDKFQQDHFMRH--
A0A3B4U5H8_BMF-01       RRQGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQ
A0A3B4V919_BCL2L11      RRSSSGYFSFDSDSLPSSPLSPRPATVERTTQTPSPTSQVMKHALQRMAE
A0A3B4VFC5_BAD-01       -------FRGRSKSAPPALWAAKKYGQKLRRMSDEFDSLLDKGEMRKVKS
                                    ..                       . . .  :     

A0A3B4UNJ0_BMF-01       --------QRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR------
A0A3B4U5H8_BMF-01       N-------QRNQGPLWWRLAVALLSLLFDRGLIAGGGGAGRR------
A0A3B4V919_BCL2L11      AHGGGARMQQQHGELK--------PALLKHTKMTSQCCQTHFC-----
A0A3B4VFC5_BAD-01       A--GTAKQMHHSKSWW--------SYLFSHQETEGENNHHENHTHRTE
                                 .:    .          *: .                  

© 1998-2019