Dataset for protein Bmf of organism Seriola dumerili

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4U5H8_BMF-01      MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAK
A0A3B4UNJ0_BMF-01      MDDEEEDMSQPISHLWGTSFRDVKYEDRAT-------PIAAGQALTAVTA
                       *****:*: :* .* * *:**::* ***.*       .:  *    .*: 

A0A3B4U5H8_BMF-01      EPRPLFYGNAGFRLHFPAHFELVGDQEARRQGSGEERNGMEQLPRQQPVA
A0A3B4UNJ0_BMF-01      APLILF-------VWWVPHWELSPSTKMNMLRFSENR-------PEEQAG
                        *  **       :.: .*:**  . : .    .*:*        :: ..

A0A3B4U5H8_BMF-01      RSVEACIGQKLQLIGDQFHREHLQLYHQNQRNQGPLWWRLAVALLSLLFD
A0A3B4UNJ0_BMF-01      VSVEAQIGRKLREIGDKFQQDH---FMRHQRQNLPAWMRLTMALFGFLFP
                        **** **.**. ***:*:.:*   : .:**:: * * **::**:.:** 

A0A3B4U5H8_BMF-01      RGLIAGGGGAGRR
A0A3B4UNJ0_BMF-01      RQALVPRLRGEQR
                       *  :.    . .*

© 1998-2019