Dataset for protein classical BH3-containing proteins of organism Scophthalmus maximus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U9BAC9_BAD-01      MAANFTISDSESEPSEEVEEGEVSQP----W---------TGPGEQVP--
A0A2U9CJH3_BMF-01      ---------------MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGP
                                       : **.:* :*    *          . * *.*  

A0A2U9BAC9_BAD-01      ---------PRHTLALPELRMAATGRIRLNSESNASTLSRDEELLTRWDE
A0A2U9CJH3_BMF-01      ALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFG-DQEVRGHESE
                                *  .   *   : ... :**:  :: . :. *:*:  . .*

A0A2U9BAC9_BAD-01      EAGTPTDGAPFRGRSKSAPPALWAAMKYGQKLRRMSDEFDSLLDKGEMRK
A0A2U9CJH3_BMF-01      EERSGMEQLP----RQQQPVAHSVEACIGQKLQLIGDQFH--------RE
                       *  :  :  *     :. * *  .    ****. :.*:*         *:

A0A2U9BAC9_BAD-01      VKSAGTARQMHHSQSWW-------SYLFSHQEMEGEN--NHHENHTQRNE
A0A2U9CJH3_BMF-01      HLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFLAGGGGAGRRQAHTKRRA
                         .    .* ::.  **       * **..  : * .  ...: **:*. 

A0A2U9BAC9_BAD-01      ---------------------------------------------
A0A2U9CJH3_BMF-01      KASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
                                                                    

© 1998-2019