Dataset for protein classical BH3-containing proteins of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3W979_BCL2L11-01      -------MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQ
G3WDQ2_BMF-01          MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLF
G3VRY4_BAD-01          --------MFQISEFEP--SEPGEDPSASTAPSLAPLRPGPRAAPGAHHH
G3VRY4_BAD-02          --------MFQISEFEP--SEPGEDPSASTAPSLAPLRPGPRAAPGAHHH
                                 : . : .  .  * :      *:              :  

G3W979_BCL2L11-01      GNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFVRRSPLLPRSSSGY
G3WDQ2_BMF-01          PLTH-----------------------CCGPGLR----------------
G3VRY4_BAD-01          EGAG-----------------------AGRPRLISYPPL-----------
G3VRY4_BAD-02          EKGG-----------------------AQKSQTHVSKELKASASQGRLGK
                                                  .  .                   

G3W979_BCL2L11-01      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDTASMRQSQSIPADM
G3WDQ2_BMF-01          -----SVGQEDKATQTLSPASPSQGVMLPCGVTEEPHRLFYGNAGYRLPL
G3VRY4_BAD-01          -----REGSREASPEAEAEAEQSEG--------EEERGLFRGRSSSAPPI
G3VRY4_BAD-02          GSFEGREGSREASPEAEAEAEQSEG--------EEERGLFRGRSSSAPPI
                              .    : :  : :  .                :    .    :

G3W979_BCL2L11-01      ---------------------RPEIWIAQELRRIGDEFNASYPRRGFLDN
G3WDQ2_BMF-01          PANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFH---------RL
G3VRY4_BAD-01          -----------------LWAAR---HYGSELRRMSDEFHCTFKGLPRPKS
G3VRY4_BAD-02          -----------------LWAAR---HYGSELRRMSDEFHCTFKGLPRPKS
                                            *   . . :*. :.*:*:           

G3W979_BCL2L11-01      NYQAADDHHQMVILRLLHYIIRLVWRMQ----------
G3WDQ2_BMF-01          HMQRHQQNQNHVWWQILLFLHNLALNREENRNGAGPR-
G3VRY4_BAD-01          AGTASQMRRSHGWTRTFQSW----FGRNLGKGSVGPSH
G3VRY4_BAD-02          AGTASQMRRSHGWTRTFQSW----FGRNLGKGSVGPSH
                            : ...    . :          :          

© 1998-2019