Dataset for protein Bad of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3VRY4_BAD-01      MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEGAGAGRPRLISYPPL----
G3VRY4_BAD-02      MFQISEFEPSEPGEDPSASTAPSLAPLRPGPRAAPGAHHHEKGGAQKSQTHVSKELKASA
                   ***************************************** .** ...      *    

G3VRY4_BAD-01      ------------REGSREASPEAEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSEL
G3VRY4_BAD-02      SQGRLGKGSFEGREGSREASPEAEAEAEQSEGEEERGLFRGRSSSAPPILWAARHYGSEL
                               ************************************************

G3VRY4_BAD-01      RRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
G3VRY4_BAD-02      RRMSDEFHCTFKGLPRPKSAGTASQMRRSHGWTRTFQSWFGRNLGKGSVGPSH
                   *****************************************************

© 1998-2018