Dataset for protein Bad of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B5X1T1_BAD-01      MDHTHDCVDDNPETMNEHDESDHSGTTHYPEFQRHYVSTRTGIRPRPGGRVRLYSESQVC
B5XEF1_BAD-01      MDYTHDCVDEC--------ESDHSGTTRNSEFQLH-VSTTMSNRPRPGERVRLYSESQVR
                   **:******:         ********. .*** * ***  . ***** ********** 

B5X1T1_BAD-01      SQVGRRDNTEFQDVMTPTEEGGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWL
B5XEF1_BAD-01      SQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWL
                   ****.*::******************.**.*******:******** *************

B5X1T1_BAD-01      DKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
B5XEF1_BAD-01      DKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
                   *** ***** * * **:*************:*****

© 1998-2018