Dataset for protein Bmf of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TW86_BMF-02      MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K6TW86_BMF-01      MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
A0A2K6TW86_BMF-03      MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K6TW86_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6TW86_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6TW86_BMF-03      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
                       ***********************************************. *

A0A2K6TW86_BMF-02      GYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6TW86_BMF-01      GYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6TW86_BMF-03      E-----PKSCVVAGPPLPAQPGFEWRRKQEWGRSE---------------
                             * *  .. *     *  :*... *   :                

A0A2K6TW86_BMF-02      QHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR
A0A2K6TW86_BMF-01      QHQQNRNRVWWQVLLFLHNLALNGEENRNGAGPR
A0A2K6TW86_BMF-03      ----------------------------------
                                                         

© 1998-2018