Dataset for protein Bim of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K6TRZ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        *****************************************         

A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
A0A2K6TRZ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSVLSRSSSGYFSFD
                                                                          

A0A2K6TRZ5_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM---DEATGSSLALRREVQC
A0A2K6TRZ5_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGDISLWFRFIFT
A0A2K6TRZ5_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD---------------
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
A0A2K6TRZ5_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWI
                         ******************************                   

A0A2K6TRZ5_BCL2L11      PLEWLAKSS-----------------------------------------
A0A2K6TRZ5_BCL2L11      FFDLYGYHHSQGTEQLHHKYVS----------------------------
A0A2K6TRZ5_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K6TRZ5_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K6TRZ5_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      --------------------------------------------------
A0A2K6TRZ5_BCL2L11      AQELRRIGDEFNAYYPRRISLPPD--------------------------
A0A2K6TRZ5_BCL2L11      AQELRRIGDEFNAYYPRRLEK-----------------------------
                                                                          

© 1998-2018