Dataset for protein Bad of organism Saimiri boliviensis boliviensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6TG62_BAD-01      MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K6TG62_BAD-02      MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASH
A0A2K6TG62_BAD-03      MFQIPEFEPSEQEDSSSAERGLSPSTAGDSPPGSGKHRRQAPGLPGDASH
                       **************************************************

A0A2K6TG62_BAD-01      QQGQPTSSSHHGGAGAVETRSRHSS-------------------------
A0A2K6TG62_BAD-02      QQGQPTSSSHHGGTSSPEERGHSNA------------DAAKLQLDASHPV
A0A2K6TG62_BAD-03      QQGQPTSSSHHGENPSAKMLSKASAGMSAPATDSEAQHTENVKLEALEPW
                       ************   : :  .. .:                         

A0A2K6TG62_BAD-01      --------YPAGTEGDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRM
A0A2K6TG62_BAD-02      LVG--------SELGQGRLRSLPVTFAPHPETLPAPIALGGHLGHGRKCF
A0A2K6TG62_BAD-03      RHGVATARTPQGRRGTKGWRRSPALFGAVRARHPPTSGQHSDMAAS----
                                  .  *       *  *       *.        .      

A0A2K6TG62_BAD-01      SDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLGRGGSAPSQ
A0A2K6TG62_BAD-02      L-----------------------------------------QGGLTQIP
A0A2K6TG62_BAD-03      ------------------------------------------SGG-----
                                                                  **     

A0A2K6TG62_BAD-01      ----
A0A2K6TG62_BAD-02      FRCV
A0A2K6TG62_BAD-03      ----
                           

© 1998-2018