Dataset for protein Noxa of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLS
A0A2K6NC45_PMAIP1-      MPGKKARKNAQPSPARAQA-------------------------------
                        *******************                               

A0A2K6NC45_PMAIP1-      SSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRN
A0A2K6NC45_PMAIP1-      ----------ELEVECATQLRRFGDKLNFRQKLL----------------
                                  * :*: * .   :. :  :**. *                

A0A2K6NC45_PMAIP1-      LTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW-
A0A2K6NC45_PMAIP1-      -----------------------NLIAKLFCSGT
                                               ::  .*.*.  

© 1998-2018