Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUM5_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6PUM5_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6RAW8_BMF-02       ----------------------------------------MEPSRCVEEL
A0A2K6RAW8_BMF-01       ----------------------------------------MEPSRCVEEL
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------MARARQEGSSPE
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6QIL2_BCL2L11      --------------------------------------MAKQPSDVSSEC
                                                                          

A0A2K6NC45_PMAIP1-      -----------------------------------------MPGKKARKN
A0A2K6QK74_BIK-01       MEDSDM-LALRLACIGDE-------------MDVSLRAPRLAQLSEVAMH
A0A2K6PUM5_BAD-01       EDSSSAERGLGPSPAGDR-------------PSDSGKHHRQAP-------
A0A2K6PUM5_BAD-02       EDSSSAERGLGPSPAGDR-------------PSDSGKHHRQAP-------
A0A2K6RAW8_BMF-02       EDDV---------------------------FQPEDGEPGAQPGSSLSAD
A0A2K6RAW8_BMF-01       EDDV---------------------------FQPEDGEPGAQPGSSLSAD
A0A2K6QZU4_BBC3-04      ---------------------------IKFGVGSARACPCQVPRA--SSA
A0A2K6QZU4_BBC3-01      PVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAP
A0A2K6NC45_PMAIP1-      --------------------------------MPGKKARKNAQPSPARAQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
A0A2K6QIL2_BCL2L11      DREGRQ-------------------------LQPAERPPQLRPGAPTSLQ
                                                                          

A0A2K6NC45_PMAIP1-      AQPSP---------------------------------------------
A0A2K6QK74_BIK-01       SLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFW--------------
A0A2K6PUM5_BAD-01       ----GLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEE
A0A2K6PUM5_BAD-02       ----GLLWDASHQQEQPTSSSHHGG--------RAWYYPAESEDSENPSA
A0A2K6RAW8_BMF-02       LFAQSLLD---------------------CPLSRLQLFPLTHCCGPGLRP
A0A2K6RAW8_BMF-01       LFAQSLLD---------------------CPLSRLQLFPLTHCCGPGLRP
A0A2K6QZU4_BBC3-04      TWVPCQIC---------------------GPQPSLSLAEQHLESPVPSAP
A0A2K6QZU4_BBC3-01      TAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAP
A0A2K6NC45_PMAIP1-      AGPAG------------------------TAGTARDQAGLGIGMQLHFTR
A0A2K6QIL2_BCL2L11      TEPQ----------------------------------------------
A0A2K6QIL2_BCL2L11      TEPQ----------------------------------------------
A0A2K6QIL2_BCL2L11      TEPQ----------------------------------------------
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
A0A2K6QIL2_BCL2L11      TEPQG------------------------NPED--NHGGEGDSCPHGSPQ
                                                                          

A0A2K6NC45_PMAIP1-      ----------------------------------------ARAQAELEVE
A0A2K6QK74_BIK-01       -------RSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK--------
A0A2K6PUM5_BAD-01       EPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGT
A0A2K6PUM5_BAD-02       RMLAEASAGMSAPATDSEAQ--------LAENVKLEALGLWRPGVATAPT
A0A2K6RAW8_BMF-02       TSQEDKATQ-TLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPP
A0A2K6RAW8_BMF-01       TSQEDKATQ-TLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
A0A2K6QZU4_BBC3-04      GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---E
A0A2K6QZU4_BBC3-01      GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---E
A0A2K6NC45_PMAIP1-      GKKLLSSSP------------------LALPRGHEEQVQVARSRVCYSTQ
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A2K6QIL2_BCL2L11      ----------------------------------------DRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
A0A2K6QIL2_BCL2L11      GPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCD
                                                                          

A0A2K6NC45_PMAIP1-      CATQLRRFGDKLNFRQKLLNLIAKLFCSGT--------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A2K6PUM5_BAD-01       ATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------------------
A0A2K6PUM5_BAD-02       PRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG----------
A0A2K6RAW8_BMF-02       L-------PAQPCFEWRRE-------------------------------
A0A2K6RAW8_BMF-01       AVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWW
A0A2K6QZU4_BBC3-04      QQRHRPS-PWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6QZU4_BBC3-01      QQRHRPS-PWRVLYNLIMGLLPLPRGHRAPEMEPN---------------
A0A2K6NC45_PMAIP1-      EIWRQTE-LPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRC--TFH
A0A2K6QIL2_BCL2L11      ---------------------ASRRQAEPADMRPEIRIAQELRRIGDEFN
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMVVILED----------IGDTSLWFGFIFT
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMVREIEEVVV--------------------
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMANWD-------------------------
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMGIFE-------------------------
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
A0A2K6QIL2_BCL2L11      KSTQTPS-PPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------
A0A2K6PUM5_BAD-01       --------------------------------------
A0A2K6PUM5_BAD-02       --------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------------
A0A2K6RAW8_BMF-01       QILLFLHNLALNGEENRNGAGPR---------------
A0A2K6QZU4_BBC3-04      --------------------------------------
A0A2K6QZU4_BBC3-01      --------------------------------------
A0A2K6NC45_PMAIP1-      QFEERLHCNW----------------------------
A0A2K6QIL2_BCL2L11      AYYARRLAKLLASST-----------------------
A0A2K6QIL2_BCL2L11      GLDLYVVWIYIYHHSQDTEQLNHRDFS-----------
A0A2K6QIL2_BCL2L11      AYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------
A0A2K6QIL2_BCL2L11      AYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      AYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      AYYARRMSLPPD--------------------------
A0A2K6QIL2_BCL2L11      AYYARRLEK-----------------------------
                                                              

© 1998-2019