Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------------------MEPSRCVEELEDDV----
A0A2K6RAW8_BMF-01       --------------------------------MEPSRCVEELEDDV----
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2K6QZU4_BBC3-01      ------------------------MARARQEGSSPEPVEGLARDGPRPFP
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUM5_BAD-02       ------------------------------MFQIPEFEPSEQEDSS----
A0A2K6PUM5_BAD-01       ------------------------------MFQIPEFEPSEQEDSS----
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
                                                                          

A0A2K6NC45_PMAIP1-      ---------------------------MPGKKARKNAQPSP---------
A0A2K6RAW8_BMF-02       -----------------FQPEDGEPGAQPGSSLSADLFAQSLLD------
A0A2K6RAW8_BMF-01       -----------------FQPEDGEPGAQPGSSLSADLFAQSLLD------
A0A2K6QZU4_BBC3-04      -------------IKFGVGSARACPCQVPRA--SSATWVPCQIC------
A0A2K6QZU4_BBC3-01      LGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALGGPR
A0A2K6QK74_BIK-01       MEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA---------
A0A2K6PUM5_BAD-02       --------------SAERGLGPSPAGDRPSDSGKHHRQAPG---------
A0A2K6PUM5_BAD-01       --------------SAERGLGPSPAGDRPSDSGKHHRQAPG---------
A0A2K6NC45_PMAIP1-      ------------------MPGKKARKNAQPSPARAQAGPAG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
A0A2K6QIL2_BCL2L11      --------------GRQLQPAERPPQLRPGAPTSLQTEPQG---------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW8_BMF-02       ---------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPA
A0A2K6RAW8_BMF-01       ---------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPA
A0A2K6QZU4_BBC3-04      ---------------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGV
A0A2K6QZU4_BBC3-01      WPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGV
A0A2K6QK74_BIK-01       ---------------FIYD-------------------------------
A0A2K6PUM5_BAD-02       ---------------LLWDASHQQEQPTSSSHHGG--------RAWYYPA
A0A2K6PUM5_BAD-01       ---------------LLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPA
A0A2K6NC45_PMAIP1-      ---------------TAGTARDQAGLGIGMQLHFTRGKKLLSSSP-----
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
A0A2K6QIL2_BCL2L11      ---------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPFAT
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW8_BMF-02       SPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-------PAQPCFE
A0A2K6RAW8_BMF-01       SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQ
A0A2K6QZU4_BBC3-04      RGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVLYN
A0A2K6QZU4_BBC3-01      RGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVLYN
A0A2K6QK74_BIK-01       ---------------------------------QTDDIRDVLTSFMDGFT
A0A2K6PUM5_BAD-02       ESE---------------------DSENPSARMLAEASAGMSAPATDSEA
A0A2K6PUM5_BAD-01       GTE---------------------EDEGMEEEPSPFRGRSRSAPPNLWAA
A0A2K6NC45_PMAIP1-      -------------LALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFE
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A2K6QIL2_BCL2L11      RSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------ARAQAELEVECATQLRRFGDKLNF
A0A2K6RAW8_BMF-02       WRRE----------------------------------------------
A0A2K6RAW8_BMF-01       HRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEE
A0A2K6QZU4_BBC3-04      LIMGLLPLPRGH--------------RAPEMEPN----------------
A0A2K6QZU4_BBC3-01      LIMGLLPLPRGH--------------RAPEMEPN----------------
A0A2K6QK74_BIK-01       TLKENIMRFWRS-------------LNPGSQVSREQVLLALLLLLAALLS
A0A2K6PUM5_BAD-02       Q--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGA
A0A2K6PUM5_BAD-01       QRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRVFQSWWD
A0A2K6NC45_PMAIP1-      SDSQTLLLRNLT--------------ASKTCIRGLQTRIFLRRC--TFHQ
A0A2K6QIL2_BCL2L11      ------ASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      HYLSAMVVILED------------------------IGDTSLWFGFIFTG
A0A2K6QIL2_BCL2L11      HYLSAMASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      HYLSAMASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      HYLSAMASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      HYLSAMVREIEE--------------VVV---------------------
A0A2K6QIL2_BCL2L11      HYLSAMGIFE----------------------------------------
A0A2K6QIL2_BCL2L11      HYLSAMANWD----------------------------------------
A0A2K6QIL2_BCL2L11      HYLSAMASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
A0A2K6QIL2_BCL2L11      HYLSAMASRRQA--------------EPADMRPEIRIAQELRRIGDEFNA
                                                                          

A0A2K6NC45_PMAIP1-      RQKLLNLIAKLFCSGT---------------------
A0A2K6RAW8_BMF-02       -------------------------------------
A0A2K6RAW8_BMF-01       NRNGAGPR-----------------------------
A0A2K6QZU4_BBC3-04      -------------------------------------
A0A2K6QZU4_BBC3-01      -------------------------------------
A0A2K6QK74_BIK-01       GGLHLLLK-----------------------------
A0A2K6PUM5_BAD-02       ARAPRPLTSGQHSDMAASSGG----------------
A0A2K6PUM5_BAD-01       RNLGRGSSAPSQ-------------------------
A0A2K6NC45_PMAIP1-      FEERLHCNW----------------------------
A0A2K6QIL2_BCL2L11      YYARRLAKLLASST-----------------------
A0A2K6QIL2_BCL2L11      LDLYVVWIYIYHHSQDTEQLNHRDFS-----------
A0A2K6QIL2_BCL2L11      YYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      YYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      YYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIL2_BCL2L11      -------------------------------------
A0A2K6QIL2_BCL2L11      -------------------------------------
A0A2K6QIL2_BCL2L11      -------------------------------------
A0A2K6QIL2_BCL2L11      YYARRMSLPPD--------------------------
A0A2K6QIL2_BCL2L11      YYARRLEK-----------------------------
                                                             

© 1998-2018