Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      -------------------------------------------------M
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6RAW8_BMF-02       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6QK74_BIK-01       ----MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFD
A0A2K6PUM5_BAD-02       ------------------------------------------MFQIPEFE
A0A2K6PUM5_BAD-01       ------------------------------------------MFQIPEFE
A0A2K6RAW8_BMF-01       MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6QZU4_BBC3-01      -----MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLA
A0A2K6QZU4_BBC3-04      ------IKFGVGSAR-------------------------ACPCQVPRAS
A0A2K6NC45_PMAIP1-      -------------------------------------------------M
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
A0A2K6QIL2_BCL2L11      -----MAKQPSDVSS-------------------------ECDREGRQLQ
                                                                          

A0A2K6NC45_PMAIP1-      PGKKA-----------------------------RKNAQPSPAR------
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQA------
A0A2K6RAW8_BMF-02       PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR------
A0A2K6QK74_BIK-01       PLECMEDSDM-------------------------LALRLACIGDEMDVS
A0A2K6PUM5_BAD-02       PSEQEDSSSA------------------------ERGLGPSPAGDRPSDS
A0A2K6PUM5_BAD-01       PSEQEDSSSA------------------------ERGLGPSPAGDRPSDS
A0A2K6RAW8_BMF-01       PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR------
A0A2K6QZU4_BBC3-01      ATPAA--PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGP
A0A2K6QZU4_BBC3-04      SATWV--PCQICGP--------------------QPSL------------
A0A2K6NC45_PMAIP1-      PGKKA--RKNAQPS--------------------PARAQAGPAG----TA
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQ-------
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQ-------
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
A0A2K6QIL2_BCL2L11      PAERP--PQLRPGA--------------------PTSLQTEPQG----NP
                        .                                                 

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6RAW8_BMF-02       --------------------LFYAPAEPKSRVVADP--------------
A0A2K6QK74_BIK-01       LRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRF
A0A2K6PUM5_BAD-02       GKHHRQAP-----------GLLWDASHQQEQPTSSSHHGG--------RA
A0A2K6PUM5_BAD-01       GKHHRQAP-----------GLLWDASHQQEQPTSSSHHGGAGAVETRSRH
A0A2K6RAW8_BMF-01       ---LFYGNAGYRLPLPASFPAVL------PIGEQPPEGQWQHRAEVQIAR
A0A2K6QZU4_BBC3-01      QPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
A0A2K6QZU4_BBC3-04      ----SLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
A0A2K6NC45_PMAIP1-      GTARDQAGLGIGMQLHFTRGKKLLSSSP------------------LALP
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
A0A2K6QIL2_BCL2L11      ED--NHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRS
                                                                          

A0A2K6NC45_PMAIP1-      ---------AQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT---
A0A2K6QIL2_BCL2L11      ----------------------------------------SRRQAEPADM
A0A2K6RAW8_BMF-02       ----------------------PLPAQPCFEWRRE---------------
A0A2K6QK74_BIK-01       W---------------------RSLNPGSQVSREQVLLALLLLLAALLSG
A0A2K6PUM5_BAD-02       WYYPAESEDSENPSARMLAEASAGMSAPATDSEAQ--------LAENVKL
A0A2K6PUM5_BAD-01       SSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVD
A0A2K6RAW8_BMF-01       KLQCIADQFHR----LHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGA
A0A2K6QZU4_BBC3-01      MADDLNAQYERRRQE---EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEM
A0A2K6QZU4_BBC3-04      MADDLNAQYERRRQE---EQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEM
A0A2K6NC45_PMAIP1-      RGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLTASKTC
A0A2K6QIL2_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILED-----
A0A2K6QIL2_BCL2L11      ---------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD-------
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE-------
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV--
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM
A0A2K6QIL2_BCL2L11      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRLAKLLASST-----------------
A0A2K6RAW8_BMF-02       --------------------------------------------------
A0A2K6QK74_BIK-01       GLHLLLK-------------------------------------------
A0A2K6PUM5_BAD-02       EALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMA
A0A2K6PUM5_BAD-01       SFKGLPRP--KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ----
A0A2K6RAW8_BMF-01       GPR-----------------------------------------------
A0A2K6QZU4_BBC3-01      EPN-----------------------------------------------
A0A2K6QZU4_BBC3-04      EPN-----------------------------------------------
A0A2K6NC45_PMAIP1-      IRGLQTRIFLRRCTFHQFEERLHCNW------------------------
A0A2K6QIL2_BCL2L11      -----IGDTSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS-----
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVR
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVR
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVR
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRMSLPPD--------------------
A0A2K6QIL2_BCL2L11      RPEIRIAQELRRIGDEFNAYYARRLEK-----------------------
                                                                          

A0A2K6NC45_PMAIP1-      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K6RAW8_BMF-02       ------
A0A2K6QK74_BIK-01       ------
A0A2K6PUM5_BAD-02       ASSGG-
A0A2K6PUM5_BAD-01       ------
A0A2K6RAW8_BMF-01       ------
A0A2K6QZU4_BBC3-01      ------
A0A2K6QZU4_BBC3-04      ------
A0A2K6NC45_PMAIP1-      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      LVWRMH
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      LVWRMH
A0A2K6QIL2_BCL2L11      LVWRMH
A0A2K6QIL2_BCL2L11      ------
A0A2K6QIL2_BCL2L11      ------
                              

© 1998-2019