Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW8_BMF-02       ---------------------------------------MEPSRCVEELE
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUM5_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6PUM5_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6QZU4_BBC3-04      --------------------------------------------------
A0A2K6QZU4_BBC3-01      ---------------------------------------------MARAR
A0A2K6RAW8_BMF-01       ---------------------------------------MEPSRCVEELE
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A2K6QIL2_BCL2L11      -------------------------------------MAKQPSDVSSECD
                                                                          

A0A2K6NC45_PMAIP1-      ------MPGKKARKNAQPSPARAQAELE----------------------
A0A2K6RAW8_BMF-02       DD--VFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRL----QLFPLTHC
A0A2K6QK74_BIK-01       MEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDD
A0A2K6PUM5_BAD-02       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6PUM5_BAD-01       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6QZU4_BBC3-04      ----------------------------------IKFGVGSARACPCQVP
A0A2K6QZU4_BBC3-01      QEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLP
A0A2K6RAW8_BMF-01       DD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---CPL-SRLQLFPLTHC
A0A2K6NC45_PMAIP1-      ------MPGKKARKNAQPSPARAQAGPAGTAGTARDQA-GLGIGMQLHFT
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQ----------------------
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQ----------------------
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQ----------------------
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
A0A2K6QIL2_BCL2L11      REGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHG-GEGDSCPHGSP
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW8_BMF-02       CGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSR
A0A2K6QK74_BIK-01       IRDVLTSFMDGFTTLKENIMRFW---------------------RSLNPG
A0A2K6PUM5_BAD-02       QEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSAP
A0A2K6PUM5_BAD-01       QEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAP
A0A2K6QZU4_BBC3-04      RA--SSATWVPCQIC---------------------GPQPSLSLAEQHLE
A0A2K6QZU4_BBC3-01      AAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAEQHLE
A0A2K6RAW8_BMF-01       CGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLP
A0A2K6NC45_PMAIP1-      RGKKLLSSSP-----------------------LALPRGHEEQVQVARSR
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ----------------------------------------------DRSP
A0A2K6QIL2_BCL2L11      ----------------------------------------------DRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
                                                                          

A0A2K6NC45_PMAIP1-      ----------------------------------------VECATQLRRF
A0A2K6RAW8_BMF-02       VVADPP----LPAQPCFEWRRE----------------------------
A0A2K6QK74_BIK-01       SQVSREQVLLALLLLLAALLSGGLHLLLK---------------------
A0A2K6PUM5_BAD-02       ATDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRS
A0A2K6PUM5_BAD-01       PNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRV
A0A2K6QZU4_BBC3-04      SPVPSAPGALAGGPTQAA-----------PGVRGEEEQWAREIGAQLRRM
A0A2K6QZU4_BBC3-01      SPVPSAPGALAGGPTQAA-----------PGVRGEEEQWAREIGAQLRRM
A0A2K6RAW8_BMF-01       LPASFPAVLPIGEQPPEGQWQH---------------RAEVQIARKLQCI
A0A2K6NC45_PMAIP1-      VCYSTQEIWRQTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRC
A0A2K6QIL2_BCL2L11      --------------------------ASRRQAEPADMRPEIRIAQELRRI
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMVVILED----------IGDTSLWF
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV---------------
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMGIFE--------------------
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMANWD--------------------
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRI
                                                                          

A0A2K6NC45_PMAIP1-      GDKLNFRQKLLNLIAKLFCSGT---------------------------
A0A2K6RAW8_BMF-02       -------------------------------------------------
A0A2K6QK74_BIK-01       -------------------------------------------------
A0A2K6PUM5_BAD-02       PAPFGAARAPRPLTSGQHSDMAASSGG----------------------
A0A2K6PUM5_BAD-01       FQSWWDRNLGRGSSAPSQ-------------------------------
A0A2K6QZU4_BBC3-04      ADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6QZU4_BBC3-01      ADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6RAW8_BMF-01       ADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR-----
A0A2K6NC45_PMAIP1-      --TFHQFEERLHCNW----------------------------------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRLAKLLASST-----------------------------
A0A2K6QIL2_BCL2L11      GFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS-----------------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH------
A0A2K6QIL2_BCL2L11      -------------------------------------------------
A0A2K6QIL2_BCL2L11      -------------------------------------------------
A0A2K6QIL2_BCL2L11      -------------------------------------------------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRLEK-----------------------------------
A0A2K6QIL2_BCL2L11      GDEFNAYYARRMSLPPD--------------------------------
                                                                         

© 1998-2019