Dataset for protein Puma of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6QZU4_BBC3-04      ---------------------------------------IKFGVGSARAC
A0A2K6QZU4_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAA
                                                                : *:.:: *.

A0A2K6QZU4_BBC3-04      PCQVPRA--SSATWVPCQIC---------------------GPQPSLSLA
A0A2K6QZU4_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
                        *. :* *  .:.*  *.  .                     *********

A0A2K6QZU4_BBC3-04      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6QZU4_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A2K6QZU4_BBC3-04      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6QZU4_BBC3-01      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                        *******************************************

© 1998-2018