Dataset for protein Bad of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6PUM5_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K6PUM5_BAD-01      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
                       **************************************************

A0A2K6PUM5_BAD-02      QQEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSA
A0A2K6PUM5_BAD-01      QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
                       *************        *   *** :*:.*. .    .  . . **

A0A2K6PUM5_BAD-02      PATDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRR
A0A2K6PUM5_BAD-01      PPNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTR
                       *..   **        ::::.  .  ** **   :* *.   *.:..* *

A0A2K6PUM5_BAD-02      SPAPFGAARAPRPLTSGQHSDMAASSGG
A0A2K6PUM5_BAD-01      VFQSWWDRNLGRGSSAPSQ---------
                          .:   .  *  :: .:         

© 1998-2018