Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6MCW0_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6N1A1_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6N1A1_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K6L933_BMF-02       --------------------------------------------------
A0A2K6L933_BMF-01       --------------------------------------------------
A0A2K6L933_BMF-03       --------------------------------------------------
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6KJF2_PMAIP1-      --------------------------MPGKKARKNAQPSPARAQAELE--
A0A2K6MCW0_BIK-01       MEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDD
A0A2K6N1A1_BAD-02       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6N1A1_BAD-01       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6KS56_BBC3-02      LAERTWSRGASPGALAAPGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQ
A0A2K6L933_BMF-02       ---------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSL
A0A2K6L933_BMF-01       ---------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSL
A0A2K6L933_BMF-03       ---------MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSL
A0A2K6KJF2_PMAIP1-      --------------------------MPGKKARKNAQPSPARAQAGPAGT
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2K6KJP8_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
                                                                          

A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6MCW0_BIK-01       IRDVLTSFMDGFTTLKENIMRFW---------------------RSLNPG
A0A2K6N1A1_BAD-02       QEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSAP
A0A2K6N1A1_BAD-01       QEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAP
A0A2K6KS56_BBC3-02      EEQ-----------------------------------------------
A0A2K6L933_BMF-02       LD---CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPC
A0A2K6L933_BMF-01       LD---CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPC
A0A2K6L933_BMF-03       LD---CPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPC
A0A2K6KJF2_PMAIP1-      AGTARDQAGLGIGMQLHFTRGKKLLSSSP---------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
A0A2K6KJP8_BCL2L11      PED--NHGGEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIFMRRS
                                                                          

A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6MCW0_BIK-01       SQVSREQVLLALLLLLAALLSGGLHLLLK---------------------
A0A2K6N1A1_BAD-02       ATDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRS
A0A2K6N1A1_BAD-01       PNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRV
A0A2K6KS56_BBC3-02      -----------------------------------QRHRPSPWRVLYNLI
A0A2K6L933_BMF-02       GVTEEPQ---------RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQH
A0A2K6L933_BMF-01       GVTEEPQ---------RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQH
A0A2K6L933_BMF-03       GVTEEPQ---------RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQH
A0A2K6KJF2_PMAIP1-      --LALPR---------GHEEQVQVARSRVCYSTQEIWRQTELPAETFESD
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      ------------------------DRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      ------------------------DRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A2K6KJP8_BCL2L11      SLLSRSS---------SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHY
                                                                          

A0A2K6KJF2_PMAIP1-      ------------------VECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6N1A1_BAD-02       PAPFGAARAPRPLTSGQHSDMAASSGG-----------------------
A0A2K6N1A1_BAD-01       FQSWWDRNLGRGSSAPSQ--------------------------------
A0A2K6KS56_BBC3-02      MGLLPLPRGHRAPEMEPN--------------------------------
A0A2K6L933_BMF-02       ---------------RAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQ
A0A2K6L933_BMF-01       ---------------RAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQ
A0A2K6L933_BMF-03       ---------------RAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQ
A0A2K6KJF2_PMAIP1-      SQTLLLRNLTASKTCIRGLQTRIFLRRC--TFHQFEERLHCNW-------
A0A2K6KJP8_BCL2L11      ----ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL-------
A0A2K6KJP8_BCL2L11      LSAMVVILED----------IGDTSLWFGFIFTGLDLYVVWIY-------
A0A2K6KJP8_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLN-------
A0A2K6KJP8_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLN-------
A0A2K6KJP8_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLN-------
A0A2K6KJP8_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK--------
A0A2K6KJP8_BCL2L11      LSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLP-------
A0A2K6KJP8_BCL2L11      LSAMVREIEEVVV-------------------------------------
A0A2K6KJP8_BCL2L11      LSAMANWD------------------------------------------
A0A2K6KJP8_BCL2L11      LSAMGIFE------------------------------------------
                                                                          

A0A2K6KJF2_PMAIP1-      ------------------------------------------
A0A2K6MCW0_BIK-01       ------------------------------------------
A0A2K6N1A1_BAD-02       ------------------------------------------
A0A2K6N1A1_BAD-01       ------------------------------------------
A0A2K6KS56_BBC3-02      ------------------------------------------
A0A2K6L933_BMF-02       ILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL
A0A2K6L933_BMF-01       ILLFLHNLALNGEENRNGAGPR--------------------
A0A2K6L933_BMF-03       ILLFLHNLALNGEENRNGAGPR--------------------
A0A2K6KJF2_PMAIP1-      ------------------------------------------
A0A2K6KJP8_BCL2L11      --------------LASST-----------------------
A0A2K6KJP8_BCL2L11      --------------IYHHSQDTEQLNHRDFS-----------
A0A2K6KJP8_BCL2L11      --------------NYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K6KJP8_BCL2L11      --------------NYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K6KJP8_BCL2L11      --------------NYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K6KJP8_BCL2L11      ------------------------------------------
A0A2K6KJP8_BCL2L11      --------------PD--------------------------
A0A2K6KJP8_BCL2L11      ------------------------------------------
A0A2K6KJP8_BCL2L11      ------------------------------------------
A0A2K6KJP8_BCL2L11      ------------------------------------------
                                                                  

© 1998-2019