Dataset for protein classical BH3-containing proteins of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KS56_BBC3-02      --------------------------------------LAERTWS-----
A0A2K6MCW0_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6N1A1_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6N1A1_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6L933_BMF-02       ----------------------------------------MEPSRCVEEL
A0A2K6L933_BMF-01       ----------------------------------------MEPSRCVEEL
A0A2K6L933_BMF-03       ----------------------------------------MEPSRCVEEL
A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
A0A2K6KJP8_BCL2L11      --------------------------------------MAKQPSDVSSEC
                                                                          

A0A2K6KJF2_PMAIP1-      ----------------MPGKKARKNAQPSP--------------------
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------------
A0A2K6KS56_BBC3-02      ----------------RGASPGALAAPGV---------------------
A0A2K6MCW0_BIK-01       MEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDD
A0A2K6N1A1_BAD-02       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6N1A1_BAD-01       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASHQ
A0A2K6L933_BMF-02       EDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---CPLSRLQLFPLTHC
A0A2K6L933_BMF-01       EDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---CPLSRLQLFPLTHC
A0A2K6L933_BMF-03       EDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD---CPLSRLQLFPLTHC
A0A2K6KJF2_PMAIP1-      -------MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFT
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------------
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------------
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
A0A2K6KJP8_BCL2L11      DREGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSP
                                                                          

A0A2K6KJF2_PMAIP1-      ----------------------------------------------ARAQ
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K6MCW0_BIK-01       IRDVLTSFMDGFTTLKENIMRFW---------------------RSLNPG
A0A2K6N1A1_BAD-02       QEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSAP
A0A2K6N1A1_BAD-01       QEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAP
A0A2K6L933_BMF-02       CGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLP
A0A2K6L933_BMF-01       CGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLP
A0A2K6L933_BMF-03       CGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLP
A0A2K6KJF2_PMAIP1-      RGKKLLSSSP-----------------------LALPRGHEEQVQVARSR
A0A2K6KJP8_BCL2L11      ----------------------------------------------DRSP
A0A2K6KJP8_BCL2L11      ----------------------------------------------DRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6KJP8_BCL2L11      QGPLAPPASPGPFATR-----SPLFIFMRRSSLLSRSSSGYFSFDTDRSP
                                                                          

A0A2K6KJF2_PMAIP1-      AELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT--------------
A0A2K6KJP8_BCL2L11      ---------------------------ASRRQAEPADMRPEIRIAQELRR
A0A2K6KS56_BBC3-02      ---------------------------AGRRRSGPG-------IGAQLRR
A0A2K6MCW0_BIK-01       SQVSREQVLLALLLLLAALLSGGLHLLLK---------------------
A0A2K6N1A1_BAD-02       ATDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRS
A0A2K6N1A1_BAD-01       PNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRV
A0A2K6L933_BMF-02       LPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQN
A0A2K6L933_BMF-01       LPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQN
A0A2K6L933_BMF-03       LPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQN
A0A2K6KJF2_PMAIP1-      VCYSTQEIWRQ-TELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRR
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMVVILED----------IGDTSLW
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRR
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRR
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRR
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMANWD-------------------
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMGIFE-------------------
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMVREIEEVVV--------------
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRR
A0A2K6KJP8_BCL2L11      APMSCDKSTQT-PSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRR
                                                                          

A0A2K6KJF2_PMAIP1-      --------------------------------------------------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRLAKLLASST-----------------------------
A0A2K6KS56_BBC3-02      MARRLNAQYRRRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6MCW0_BIK-01       --------------------------------------------------
A0A2K6N1A1_BAD-02       PAPFGAARAPRPLTSGQHSDMAASSGG-----------------------
A0A2K6N1A1_BAD-01       FQSWWDRNLGRGSSAPSQ--------------------------------
A0A2K6L933_BMF-02       RNRVWWQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL-
A0A2K6L933_BMF-01       RNRVWWQILLFLHNLALNGEENRNGAGPR---------------------
A0A2K6L933_BMF-03       RNRVWWQILLFLHNLALNGEENRNGAGPR---------------------
A0A2K6KJF2_PMAIP1-      CTFHQFEERLHCNW------------------------------------
A0A2K6KJP8_BCL2L11      FGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS-----------------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      --------------------------------------------------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRMSLPPD--------------------------------
A0A2K6KJP8_BCL2L11      IGDEFNAYYARRLEK-----------------------------------
                                                                          

© 1998-2018