Dataset for protein Bmf of organism Rhinopithecus bieti

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6L933_BMF-02      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6L933_BMF-03      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
A0A2K6L933_BMF-01      MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLF
                       **************************************************

A0A2K6L933_BMF-02      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6L933_BMF-03      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6L933_BMF-01      PLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNA
                       **************************************************

A0A2K6L933_BMF-02      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6L933_BMF-03      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6L933_BMF-01      GYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQ
                       **************************************************

A0A2K6L933_BMF-02      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGR
A0A2K6L933_BMF-03      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR----------------
A0A2K6L933_BMF-01      QHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR----------------
                       **********************************                

A0A2K6L933_BMF-02      LMCL
A0A2K6L933_BMF-03      ----
A0A2K6L933_BMF-01      ----
                           

© 1998-2018