Dataset for protein classical BH3-containing proteins of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q925D2_BIK-01          MSEARLMARDIIKT---------------LLHDQVPQPAVVSGAPSMKEP
O35147_BAD-01          MGTPKQPSLAPAHALGLRKSDPGIRSLG----SDAGGRRWRPAAQSMFQI
Q8K589_BMF-01          --MEPPQCVEELEDDV-------------FQPEDGEPGT-QPGSLLSADL
Q80ZG6_BBC3-01         MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAA
O88498_BCL2L11-02      MAKQPSDVNSECDREG-----------GQLQPAERPPQL-RPGAPTSLQT
O88498_BCL2L11-01      MAKQPSDVNSECDREG-----------GQLQPAERPPQL-RPGAPTSLQT
P62817_HRK-01          --------MCPCPRHR-----------GRGPPAVCGCGDARPGLRWAAAQ
Q5U777_PMAIP1-01       MPGRKARRNAPLNPTR-----------AELPPEFA------AQLRKIGDK
Q6P7C5_BAD-01          ----------MGTPKQ-----------PSLAPAHA------LGLRK----
                                                                         

Q925D2_BIK-01          VGVEDVSP------------------------------------------
O35147_BAD-01          PEFEPSEQEDASTT--------DRGLGPSLTEDQPGPYLAPGLLGSIVQQ
Q8K589_BMF-01          FAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQE------------------
Q80ZG6_BBC3-01         PALLPAAYLCAPTAPPAVTAALGGPRWPGGHRSR----------------
O88498_BCL2L11-02      ESQ-----------------------------------------------
O88498_BCL2L11-01      ESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
P62817_HRK-01          V----T--------------------------------------------
Q5U777_PMAIP1-01       VYCTWS--------------------------------------------
Q6P7C5_BAD-01          -----S--------------------------------------------
                                                                         

Q925D2_BIK-01          ---------VRDLDFMRCLESRNQVALRLA-----------------CIG
O35147_BAD-01          QPGQAANNSHHGGAGTMETRSRHSSYPAGT-----------------EED
Q8K589_BMF-01          ---------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLP
Q80ZG6_BBC3-01         ---------PRGPRP-------DGPQPSLS-----------------PAQ
O88498_BCL2L11-02      ---------DRSPAPMSCDKSTQTPSPPCQ-----------------AFN
O88498_BCL2L11-01      SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ-----------------AFN
P62817_HRK-01          ---------ALRLQALGDELHRRAMRRRAR------------------PR
Q5U777_PMAIP1-01       ---------APDITAVLAQMPGKKSRKSTM------------------RR
Q6P7C5_BAD-01          ---------DPGIRSLGSDAGGRRWRPAAQ------------------SM
                                                                         

Q925D2_BIK-01          DEMDRCLRSPRLVQLPGIAMHRLAATYSQT----GVRGIFRSLIGSLTNL
O35147_BAD-01          EGMEEELSPFRGRSRSAPPNLWAAQRYGRE---------LRRMSDEFEGS
Q8K589_BMF-01          ASFPAGSALGEQPPEGQFLQHRAEVQIARK---------LQCIADQFH--
Q80ZG6_BBC3-01         QHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQ
O88498_BCL2L11-02      HYLSAMASIRQS--QEEPEDLRPEIRIAQE---------LRRIGDEFNET
O88498_BCL2L11-01      HYLSAMASIRQS--QEEPEDLRPEIRIAQE---------LRRIGDEFNET
P62817_HRK-01          DPLPALLPA--------LRARWPWLCAAAQ---------VAALAAWLLGR
Q5U777_PMAIP1-01       SPSPTRVPADLKDECDQLRRIGDKVNLRQK---------LLNFISKLFNL
Q6P7C5_BAD-01          FQIPEFEPSEQEDASTTDRGLGPSLTEDQP---------GPYLAPGLLGS
                                                                 :   :   

Q925D2_BIK-01          RENIWSWRVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ-----
O35147_BAD-01          FKGLPRPKSAGTATQMRQSASWTRIIQSW-------WDRNLGKGGSTPSQ
Q8K589_BMF-01          -------RLHMQQHQQNRDRAWRQVFLFLQNL-ALNRRENREGVGPW---
Q80ZG6_BBC3-01         YE----RRRQEEQHRH-RPSPWRVMYNLFMGLLPLPRDPGAPEMEPN---
O88498_BCL2L11-02      YT----RRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH----------
O88498_BCL2L11-01      YT----RRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH----------
P62817_HRK-01          RSA-----------------------------------------------
Q5U777_PMAIP1-01       IT------------------------------------------------
Q6P7C5_BAD-01          IVQQQPGQAANNSHHGGRFLTSIIFLSHVP--------------------
                                                                         

© 1998-2018