Dataset for protein Bim of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O88498_BCL2L11-02      MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQ---------
O88498_BCL2L11-01      MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDR
                       *****************************************         

O88498_BCL2L11-02      -----------------------------------------------DRS
O88498_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                      ***

O88498_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQEL
O88498_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQEL
                       **************************************************

O88498_BCL2L11-02      RRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
O88498_BCL2L11-01      RRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
                       **********************************************

© 1998-2018