Dataset for protein Bad of organism Rattus norvegicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O35147_BAD-01      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTT
Q6P7C5_BAD-01      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTT
                   ************************************************************

O35147_BAD-01      DRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEE
Q6P7C5_BAD-01      DRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGG-------------------
                   *****************************************                   

O35147_BAD-01      DEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQ
Q6P7C5_BAD-01      --------------------------RFLTSIIFLSH--------VP-------------
                                             *:  .:  :*         :*             

O35147_BAD-01      SASWTRIIQSWWDRNLGKGGSTPSQ
Q6P7C5_BAD-01      -------------------------
                                            

© 1998-2018