Dataset for protein classical BH3-containing proteins of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4BVX1_BCL2L11      LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSG
A0A3B4CPH6_BAD-01       ----------------------------------------MAHMFTLSDD
A0A3B4CNJ8_BMF-01       -----------------------------MDEDEDDVF-VMDTQYWRSSI
A0A3B4DUY7_BAD-01       ------------------------MSNQYLQKLRRARF-----------N
A0A3B4BVX1_BCL2L11      -----------------------------MQNSNYCCF--EQGESGQSSG
A0A3B4BVX1_BCL2L11      -------------------------MSRRSNRAGRPAFLKEQGESGQSSG
                                                                          

A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVR----GGITMPNSLLGYQSRSPLFRTLSR
A0A3B4CPH6_BAD-01       SDTSEDLGDADQPEASK---------------RAELSQSGQHPLVPERFR
A0A3B4CNJ8_BMF-01       REIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLAPSVR
A0A3B4DUY7_BAD-01       CEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACAMEKHSEDGISTMDDQ
A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVR----GGITMPNSLLGYQSRSPLFRTLSR
A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVR----GGITMPNSLLGYQSRSPLFRTLSR
                           .      .                        :   .   :     .

A0A3B4BVX1_BCL2L11      SSSGYFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTF
A0A3B4CPH6_BAD-01       ESRQRNHSMNEDALQESG--------------------------------
A0A3B4CNJ8_BMF-01       PEHVEGAMLQEDQLAMEP--------------------------------
A0A3B4DUY7_BAD-01       DESNWSETVKNGDSPQLD-----SQHSMASNISPASPDELSEVGCRVRLY
A0A3B4BVX1_BCL2L11      SSSGYFSFESEPSSPLLT--------SPSLSVCST---------------
A0A3B4BVX1_BCL2L11      SSSGYFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTF
                         .       .:                                       

A0A3B4BVX1_BCL2L11      ELWPLY--------------------NHHPPHG---AAPAGDMRPESYVA
A0A3B4CPH6_BAD-01       -----------------AVRHGDGAADGDSFRRRCRSAPPALWAAKKY-G
A0A3B4CNJ8_BMF-01       --------------------------RRRPPHS-----------VEARIG
A0A3B4DUY7_BAD-01       SESQVYTVSRWQDNEDGLLAEDGGAGDGAPFRGRSQSAPAALWKAKKY-G
A0A3B4BVX1_BCL2L11      ELWPLY--------------------NHHPPHG---AAPAGDMRPESYVA
A0A3B4BVX1_BCL2L11      ELWPLY--------------------NHHPPHG---AAPAGDMRPESYVA
                                                     . .             :   .

A0A3B4BVX1_BCL2L11      QELRRIGDEF--NELYFHGVSQLHGCVAGMQ----------ALSNPVAFS
A0A3B4CPH6_BAD-01       RQLRKMSDEF--DTLLDKGMKRVRSAGAARQ----------MHASPSWFT
A0A3B4CNJ8_BMF-01       QKLQMIGDQFYQEHMLQHRNQRNQQPFW-------------LRLASALYT
A0A3B4DUY7_BAD-01       RQLRRMSDEF--DTWLDKGDTRRASSPG-------------KQTNRGWFS
A0A3B4BVX1_BCL2L11      QELRRIGDEF--NELYFHGVSQLHGCVAGMQ----------ALSARDLHD
A0A3B4BVX1_BCL2L11      QELRRIGDEF--NELYFHGAGRNGGRVQLPAEEEPAFMLWLGLVIRRLLE
                        .:*. :.*:*  :    :   .                            

A0A3B4BVX1_BCL2L11      ILGLFRGH-----------------
A0A3B4CPH6_BAD-01       FLWSHKESDSEASSSLTAPDTRPAE
A0A3B4CNJ8_BMF-01       LLFEREPVANGRRVDQR--------
A0A3B4DUY7_BAD-01       FLWGSKEEEGRE-------------
A0A3B4BVX1_BCL2L11      QMFALS-------------------
A0A3B4BVX1_BCL2L11      VLLRRR-------------------
                         :                       

© 1998-2019