Dataset for protein Bim of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4BVX1_BCL2L11      LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSG
A0A3B4BVX1_BCL2L11      -----------------------------MQNSNYCCF--EQGESGQSSG
A0A3B4BVX1_BCL2L11      -------------------------MSRRSNRAGRPAFLKEQGESGQSSG
                                                      :.:.  .*  **********

A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
A0A3B4BVX1_BCL2L11      AASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSG
                        **************************************************

A0A3B4BVX1_BCL2L11      YFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWP
A0A3B4BVX1_BCL2L11      YFSFESEPSSPLLT--------SPSLSVCST---------------ELWP
A0A3B4BVX1_BCL2L11      YFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWP
                        ************:*        *** .* :                ****

A0A3B4BVX1_BCL2L11      LYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAG
A0A3B4BVX1_BCL2L11      LYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAG
A0A3B4BVX1_BCL2L11      LYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGAGRNGGRVQL
                        ****************************************...  * *  

A0A3B4BVX1_BCL2L11      MQ----------ALSNPVAFSILGLFRGH
A0A3B4BVX1_BCL2L11      MQ----------ALSARDLHDQ--MFALS
A0A3B4BVX1_BCL2L11      PAEEEPAFMLWLGLVIRRLLEV--LLRRR
                                    .*      .   ::   

© 1998-2019