Dataset for protein Bad of organism Pygocentrus nattereri

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B4CPH6_BAD-01      MAHMFTL-------------------------------------------
A0A3B4DUY7_BAD-01      MSNQYLQKLRRARFNCEEERYKKVIKTLTGEKGTPFNPLCWNSLRTTACA
                       *:: :                                             

A0A3B4CPH6_BAD-01      --------------SDDSDTSEDLGDADQPEASKRAELSQSGQHPLVPER
A0A3B4DUY7_BAD-01      MEKHSEDGISTMDDQDESNWSETVKNGDSPQLDSQHSMA-SNISPASPDE
                                     .*:*: ** : :.*.*: ... .:: *.  *  *: 

A0A3B4CPH6_BAD-01      FRESRQRNHSMNEDAL--------QESGAVRHGDGAADGDSFRRRCRSAP
A0A3B4DUY7_BAD-01      LSEVGCRVRLYSESQVYTVSRWQDNEDGLLAEDGGAGDGAPFRGRSQSAP
                       : *   * .  .*. :        :*.* :  ..**.** .** *..***

A0A3B4CPH6_BAD-01      PALWAAKKYGRQLRKMSDEFDTLLDKGMKRVRSAGAARQMHASPSWFTFL
A0A3B4DUY7_BAD-01      AALWKAKKYGRQLRRMSDEFDTWLDKGDTR-RASSPGKQ--TNRGWFSFL
                       .*** *********.******* **** .* *::....*  :. .**:**

A0A3B4CPH6_BAD-01      WSHKESDSEASSSLTAPDTRPAE
A0A3B4DUY7_BAD-01      WGSKEEEGRE-------------
                       *. **.:.               

© 1998-2019