Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FFR1_BMF-01       --------------------------------------MEPSH------C
A0A2K6FQZ3_BBC3-01      ---------------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAV
A0A2K6FFR1_BMF-02       --------------------------------------MEPSH------C
A0A2K6FM79_BIK-01       MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSG------C
A0A2K6GWV0_BAD-01       MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG-------
A0A2K6FQZ3_BBC3-04      ---------------------------------------MKFG------A
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6EM90_PMAIP1-      -------------------------------------MPVKK-------A
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG------S
A0A2K6GL98_HRK-01       ----------------------------------MCPCPLHRG--RGPPA
                                                                          

A0A2K6FFR1_BMF-01       VEELEDDVFQPEDGESGTQPG----SVLSADLFAQSQLDCPLSRLQLFPL
A0A2K6FQZ3_BBC3-01      SCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRP
A0A2K6FFR1_BMF-02       VEELEDDVFQPEDGESGTQPG----SVLSADLFAQSQLDCPLSRLQLFPL
A0A2K6FM79_BIK-01       LEDSDEVALRLACIGDEM--------------------------------
A0A2K6GWV0_BAD-01       --DRPSGPGKHPCTAPSFLGD----ASHQ---------------------
A0A2K6FQZ3_BBC3-04      GSARAC---------PCQVPG----TSFSWWVLGHI--------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG----APTS---LQTE--------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG----APTS---LQTE--------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG----APTS---LQTE--------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG----APTS---LQTE--------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG----APTS---LQTE--------------
A0A2K6EM90_PMAIP1-      RKNAQPSPTRTRAEIEEECAL-----------------------------
A0A2K6GE31_BCL2L11      ECDREGGQLQSVERPPQLRPG-----------------------------
A0A2K6GL98_HRK-01       VCACSAGRLGLRSSAAQLTAA-----------------------------
                                                                          

A0A2K6FFR1_BMF-01       THCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR--------
A0A2K6FQZ3_BBC3-01      RGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVR--------
A0A2K6FFR1_BMF-02       THCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQR--------
A0A2K6FM79_BIK-01       -------------------DLCLRSPRLAWLPGMTMHSLGLA--------
A0A2K6GWV0_BAD-01       ------QGQPSSSSHHGGAGSVETRSRHSSYPAGTEEDEGMEEEPSPFRG
A0A2K6FQZ3_BBC3-04      -----PGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVR--------
A0A2K6GE31_BCL2L11      -----PQ-------------------------------------------
A0A2K6GE31_BCL2L11      -----PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATR--------
A0A2K6GE31_BCL2L11      -----PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATR--------
A0A2K6GE31_BCL2L11      -----PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATR--------
A0A2K6GE31_BCL2L11      -----PQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATR--------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
                                                                          

A0A2K6FFR1_BMF-01       ----------LFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIA
A0A2K6FQZ3_BBC3-01      -----GEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWR
A0A2K6FFR1_BMF-02       -----------------------------LFYAPAEPKSHVVADPPLPTQ
A0A2K6FM79_BIK-01       -LSCDQPVRWGV------LGSLSDGFA-NLREYVARLWRSLSPRPWVCPA
A0A2K6GWV0_BAD-01       RSRSAPPNLWAAQRYGRELRRMSDEFE-DSFKKGLPRPKSAGTATQIRQS
A0A2K6FQZ3_BBC3-04      -----GEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWR
A0A2K6GE31_BCL2L11      ------------------------------DRSPAPMSCDKSTQTPSPPC
A0A2K6GE31_BCL2L11      -----SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6GE31_BCL2L11      -----SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6GE31_BCL2L11      -----SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6GE31_BCL2L11      -----SPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6EM90_PMAIP1-      ----------QLRRLGDKLH-----FQQKLLNLIAKLFRSGT--------
A0A2K6GE31_BCL2L11      ----------APTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIG---
A0A2K6GL98_HRK-01       ----------RLKALGDELH-------------QRTMWRRRARSRRAPAP
                                                                          

A0A2K6FFR1_BMF-01       RKLQCIADQFHRLHVQQHQQNQNRMWWQILLFLHNLALNGEENRNGAGPR
A0A2K6FQZ3_BBC3-01      VLYNLIMGLLPLPRGHRAPEMEPN--------------------------
A0A2K6FFR1_BMF-02       PCFERRREQERGRSQ-----------------------------------
A0A2K6FM79_BIK-01       PAWEQVLLLLLVLLLLGGGLHLLLK-------------------------
A0A2K6GWV0_BAD-01       SSWTRVIQSWWDRNVGRGGSAPSQ--------------------------
A0A2K6FQZ3_BBC3-04      VLYNLIMGLLPLPRGHRAPEMEPN--------------------------
A0A2K6GE31_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFL
A0A2K6GE31_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFL
A0A2K6GE31_BCL2L11      QAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRMPL
A0A2K6GE31_BCL2L11      QAFNHYLSAMVREIEEVVV-------------------------------
A0A2K6GE31_BCL2L11      QAFNHYLSAM-----GIFE-------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      DEFNAYYPRRLAKCLVPSI-------------------------------
A0A2K6GL98_HRK-01       GALTTYWPWLCAAAQVAALAAWLLGRRNL---------------------
                                                                          

A0A2K6FFR1_BMF-01       -----------------------------
A0A2K6FQZ3_BBC3-01      -----------------------------
A0A2K6FFR1_BMF-02       -----------------------------
A0A2K6FM79_BIK-01       -----------------------------
A0A2K6GWV0_BAD-01       -----------------------------
A0A2K6FQZ3_BBC3-04      -----------------------------
A0A2K6GE31_BCL2L11      NNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      NNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      PSD--------------------------
A0A2K6GE31_BCL2L11      -----------------------------
A0A2K6GE31_BCL2L11      -----------------------------
A0A2K6EM90_PMAIP1-      -----------------------------
A0A2K6GE31_BCL2L11      -----------------------------
A0A2K6GL98_HRK-01       -----------------------------
                                                     

© 1998-2019