Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6GL98_HRK-01       --------------------------------------MCPCPLHRGRGP
A0A2K6FFR1_BMF-01       MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLF--------AQSQ---
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6GE31_BCL2L11      --------------------------------------MAKQPSDVG---
A0A2K6FM79_BIK-01       ----MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSG---
A0A2K6GWV0_BAD-01       ----MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG---
A0A2K6FFR1_BMF-02       MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLF--------AQSQ---
A0A2K6FQZ3_BBC3-04      -------------------------------------------MKFG---
A0A2K6FQZ3_BBC3-01      ----MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPG---
                                                                          

A0A2K6EM90_PMAIP1-      -------------------------------------MPVKKARKNAQ--
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6GL98_HRK-01       PAVCACSAGRLGLRSS---------------------AAQLTAARLKALG
A0A2K6FFR1_BMF-01       -LDCPLSRLQLFPLTHCC-------------------GPGLRPTSQEDKA
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6GE31_BCL2L11      -SECDREGGQLQSVER---------------------PPQLRPGAPTSLQ
A0A2K6FM79_BIK-01       -CLEDSDEVALRLACI---------------------GDEM---------
A0A2K6GWV0_BAD-01       ----DRPSGPGKHPCT---------------------APSFLGDASHQQG
A0A2K6FFR1_BMF-02       -LDCPLSRLQLFPLTHCC-------------------GPGLRPTSQEDKA
A0A2K6FQZ3_BBC3-04      -AGSARACPCQVPGTSFS---------------WWVLG--------HIPG
A0A2K6FQZ3_BBC3-01      -LPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDG
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      TEPQASMRQFQAE--------------------------------PADMR
A0A2K6GL98_HRK-01       DELH---------------------------------------------Q
A0A2K6FFR1_BMF-01       TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
A0A2K6GE31_BCL2L11      TEPQGNPEGSREGEGDRCSHGSPQGPLAP----------------PASPG
A0A2K6GE31_BCL2L11      TEPQGNPEGSREGEGDRCSHGSPQGPLAP----------------PASPG
A0A2K6GE31_BCL2L11      TEPQ----------------------------------------------
A0A2K6GE31_BCL2L11      TEPQGNPEGSREGEGDRCSHGSPQGPLAP----------------PASPG
A0A2K6GE31_BCL2L11      TEPQGNPEGSREGEGDRCSHGSPQGPLAP----------------PASPG
A0A2K6FM79_BIK-01       -----------DLCLRSPRLAWLPGMTMH----------------SLGLA
A0A2K6GWV0_BAD-01       QPSSSSHHGGAGSVETRSRHSSYPAGTEE----------------DEGME
A0A2K6FFR1_BMF-02       TQTLSPASPSQGVMLPCGVTEEPQRLFYA----------------PAEPK
A0A2K6FQZ3_BBC3-04      PQ---PSLSLAEQHLESPVPSAPGALAGG----------------PTQAA
A0A2K6FQZ3_BBC3-01      PQ---PSLSLAEQHLESPVPSAPGALAGG----------------PTQAA
                                                                          

A0A2K6EM90_PMAIP1-      ---------PSPTRTRAEIEEECALQLRRLGDKL----------------
A0A2K6GE31_BCL2L11      -------------------------------------------PEIWIAQ
A0A2K6GL98_HRK-01       -------------------------------------------RTMWRRR
A0A2K6FFR1_BMF-01       ---------PAEGQWQHRAEVQIARKLQCIADQF---------HRLHVQQ
A0A2K6GE31_BCL2L11      ---------PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
A0A2K6GE31_BCL2L11      ---------PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
A0A2K6GE31_BCL2L11      ---------------------------------------DRSPAPMSCDK
A0A2K6GE31_BCL2L11      ---------PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
A0A2K6GE31_BCL2L11      ---------PFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
A0A2K6FM79_BIK-01       ---------LSCDQPVRWGV------LGSLSDGF--ANLREYVARLWRSL
A0A2K6GWV0_BAD-01       EEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEF--EDSFKKGLPRPKSA
A0A2K6FFR1_BMF-02       ---------SHVVADPPLPTQPC------------------FERRREQER
A0A2K6FQZ3_BBC3-04      ---------PGVRGEEEQWAREIGAQLRRMADDL----NAQYERRRQEEQ
A0A2K6FQZ3_BBC3-01      ---------PGVRGEEEQWAREIGAQLRRMADDL----NAQYERRRQEEQ
                                                                          

A0A2K6EM90_PMAIP1-      ----------HFQQKLLNLIAKLFRSGT----------------------
A0A2K6GE31_BCL2L11      ELRRIG---DEFNAYYPRRLAKCLVPSI----------------------
A0A2K6GL98_HRK-01       ARSRRAPAPGALTTYWPWLCAAAQVAALAAWLLGRRNL------------
A0A2K6FFR1_BMF-01       HQQNQNRMWWQILLFLHNLALNGEENRNGAGPR-----------------
A0A2K6GE31_BCL2L11      STQTPSPPCQAFNHYLSAMVREIEEVVV----------------------
A0A2K6GE31_BCL2L11      STQTPSPPCQAFNHYLSAM-----GIFE----------------------
A0A2K6GE31_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFN
A0A2K6GE31_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFN
A0A2K6GE31_BCL2L11      STQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFN
A0A2K6FM79_BIK-01       SPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK----------------
A0A2K6GWV0_BAD-01       GTATQIRQSSSWTRVIQSWWDRNVGRGGSAPSQ-----------------
A0A2K6FFR1_BMF-02       GRSQ----------------------------------------------
A0A2K6FQZ3_BBC3-04      QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----------------
A0A2K6FQZ3_BBC3-01      QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-----------------
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------
A0A2K6FFR1_BMF-01       --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------
A0A2K6GE31_BCL2L11      AYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      AYYPRRMPLPSD--------------------------
A0A2K6GE31_BCL2L11      AYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6FM79_BIK-01       --------------------------------------
A0A2K6GWV0_BAD-01       --------------------------------------
A0A2K6FFR1_BMF-02       --------------------------------------
A0A2K6FQZ3_BBC3-04      --------------------------------------
A0A2K6FQZ3_BBC3-01      --------------------------------------
                                                              

© 1998-2019