Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FFR1_BMF-01       --------------------------------------------------
A0A2K6FQZ3_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAA
A0A2K6FFR1_BMF-02       --------------------------------------------------
A0A2K6FM79_BIK-01       --------------MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNE
A0A2K6GWV0_BAD-01       --------------MFQIPE---------------FEPSEQEDSSSAGRG
A0A2K6FQZ3_BBC3-04      --------------------------------------------------
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      ------------------------------------------------MA
A0A2K6GL98_HRK-01       ------------------------------------------------MC
                                                                          

A0A2K6FFR1_BMF-01       --MEPSH----CVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPL
A0A2K6FQZ3_BBC3-01      PALLPAA----YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPS
A0A2K6FFR1_BMF-02       --MEPSH----CVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPL
A0A2K6FM79_BIK-01       ENPDPSG----CLEDSDEVALRLACIGDEM--------------------
A0A2K6GWV0_BAD-01       LGPSPSG-------DRPSGPGKHPCTAPSFLGDASHQ--------QGQPS
A0A2K6FQZ3_BBC3-04      ---MKFG----AGSARAC---------PCQVPGTSFSWWVLGHIPGPQPS
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS---LQTEPQ----
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS---LQTEPQGNPE
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS---LQTEPQGNPE
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS---LQTEPQGNPE
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS---LQTEPQGNPE
A0A2K6EM90_PMAIP1-      -MPVKK-----ARKNAQPSPTRTRAEIEEECALQLRR-------------
A0A2K6GE31_BCL2L11      KQPSDVG----SECDREGGQLQSVERPPQLRPGAPTS-------------
A0A2K6GL98_HRK-01       PCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKA-------------
                                                                          

A0A2K6FFR1_BMF-01       SRLQ----LFPLTHCCGPGLRPTSQEDKATQ--------TLSPASPSQGV
A0A2K6FQZ3_BBC3-01      LSLAEQHLESPVPSAPGALAGGPTQAAPGVR-------------GEEEQW
A0A2K6FFR1_BMF-02       SRLQ----LFPLTHCCGPGLRPTSQEDKATQ--------TLSPASPSQGV
A0A2K6FM79_BIK-01       --------DLCLRSPRLAWLPGMTMHSLGLA---------LSCDQPVRWG
A0A2K6GWV0_BAD-01       SSSHHGGAGSVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWA
A0A2K6FQZ3_BBC3-04      LSLAEQHLESPVPSAPGALAGGPTQAAPGVR-------------GEEEQW
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATR-------------SPLFIF
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATR-------------SPLFIF
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATR-------------SPLFIF
A0A2K6GE31_BCL2L11      GSREGEGDRCSHGSPQGPLAPPASPGPFATR-------------SPLFIF
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
                                                                          

A0A2K6FFR1_BMF-01       MLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQ
A0A2K6FQZ3_BBC3-01      AREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVLYNLIMGLLP
A0A2K6FFR1_BMF-02       MLPCGVTEEPQRLFYA------PAEPKSHVVADPPLPTQPCFERRREQER
A0A2K6FM79_BIK-01       V------LGSLSDGFA-NLREYVARLWRSLSPRPWVCPAPAWEQVLLLLL
A0A2K6GWV0_BAD-01       AQRYGRELRRMSDEFE-DSFKKGLPRPKSAGTATQIRQSSSWTRVIQSWW
A0A2K6FQZ3_BBC3-04      AREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVLYNLIMGLLP
A0A2K6GE31_BCL2L11      -------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMA
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMV
A0A2K6EM90_PMAIP1-      ---LGDKLH-----FQQKLLNLIAKLFRSGT-------------------
A0A2K6GE31_BCL2L11      ---LQTEPQASMRQFQAEPADMRPEIWIAQELRRIG---DEFNAYYPRRL
A0A2K6GL98_HRK-01       ---LGDELH-------------QRTMWRRRARSRRAPAPGALTTYWPWLC
                                                                          

A0A2K6FFR1_BMF-01       IARKLQCIADQFHRLHVQQHQQNQNRMWWQILLFLHNLALNGEENRNGAG
A0A2K6FQZ3_BBC3-01      LPRGHRAPEMEPN-------------------------------------
A0A2K6FFR1_BMF-02       GRSQ----------------------------------------------
A0A2K6FM79_BIK-01       VLLLLGGGLHLLLK------------------------------------
A0A2K6GWV0_BAD-01       DRNVGRGGSAPSQ-------------------------------------
A0A2K6FQZ3_BBC3-04      LPRGHRAPEMEPN-------------------------------------
A0A2K6GE31_BCL2L11      SMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADEDHPQ
A0A2K6GE31_BCL2L11      SMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADEDHPQ
A0A2K6GE31_BCL2L11      SMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRMPLPSD--------
A0A2K6GE31_BCL2L11      ----GIFE------------------------------------------
A0A2K6GE31_BCL2L11      REIEEVVV------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      AKCLVPSI------------------------------------------
A0A2K6GL98_HRK-01       AAAQVAALAAWLLGRRNL--------------------------------
                                                                          

A0A2K6FFR1_BMF-01       PR----------------
A0A2K6FQZ3_BBC3-01      ------------------
A0A2K6FFR1_BMF-02       ------------------
A0A2K6FM79_BIK-01       ------------------
A0A2K6GWV0_BAD-01       ------------------
A0A2K6FQZ3_BBC3-04      ------------------
A0A2K6GE31_BCL2L11      MLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      MLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      ------------------
A0A2K6GE31_BCL2L11      ------------------
A0A2K6GE31_BCL2L11      ------------------
A0A2K6EM90_PMAIP1-      ------------------
A0A2K6GE31_BCL2L11      ------------------
A0A2K6GL98_HRK-01       ------------------
                                          

© 1998-2018