Dataset for protein classical BH3-containing proteins of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6GL98_HRK-01       ----------------------------------MCPCPLHRGRGPPAVC
A0A2K6FFR1_BMF-02       ----------------MEPSHCVEELEDDVFQPEDGESGTQPG----SVL
A0A2K6FFR1_BMF-01       ----------------MEPSHCVEELEDDVFQPEDGESGTQPG----SVL
A0A2K6FQZ3_BBC3-04      ---------------------------------------MKFG-------
A0A2K6FQZ3_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPG-------
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6GE31_BCL2L11      ----------------------------------MAKQPSDVG----SEC
A0A2K6FM79_BIK-01       MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSG----CLE
A0A2K6GWV0_BAD-01       MFQIPE---------------FEPSEQEDSSSAGRGLGPSPSG-------
                                                                          

A0A2K6EM90_PMAIP1-      -------MPVKKARKNAQPSPTRTRAEIEE--------------------
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQASMRQFQAEPADM--------
A0A2K6GL98_HRK-01       ACSAGRLGLRSSAAQLTAARLKALGDELH---------------------
A0A2K6FFR1_BMF-02       SADLFAQSQLDCPLSRLQLFPLTHCCGPGL--------------------
A0A2K6FFR1_BMF-01       SADLFAQSQLDCPLSRLQLFPLTHCCGPGL--------------------
A0A2K6FQZ3_BBC3-04      ------AGSARACPCQVPGTSFS---------------WWVLG-------
A0A2K6FQZ3_BBC3-01      ------LPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRG
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQ---------------------
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQG--------------------
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQG--------------------
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQG--------------------
A0A2K6GE31_BCL2L11      DREGGQLQSVERPPQLRPGAPTSLQTEPQG--------------------
A0A2K6FM79_BIK-01       DSDEVALRLACIGDEM----------------------------------
A0A2K6GWV0_BAD-01       DRPSGPGKHPCTAPSFLGDASHQQGQPSSS--------------------
                                                                          

A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GL98_HRK-01       --------------------------------------------------
A0A2K6FFR1_BMF-02       -RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPK----SH
A0A2K6FFR1_BMF-01       -RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPAS
A0A2K6FQZ3_BBC3-04      -HIPGPQPSLSLAEQHLESPVPSAPGALAG---GPTQAAPGVRGEEEQWA
A0A2K6FQZ3_BBC3-01      PRPDGPQPSLSLAEQHLESPVPSAPGALAG---GPTQAAPGVRGEEEQWA
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      -NPEGSREGEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIF
A0A2K6GE31_BCL2L11      -NPEGSREGEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIF
A0A2K6GE31_BCL2L11      -NPEGSREGEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIF
A0A2K6GE31_BCL2L11      -NPEGSREGEGDRCSHGSPQGPLAPPASPG---------PFATRSPLFIF
A0A2K6FM79_BIK-01       -------DLCLRSPRLAWLPGMTMHSLGLA---------LSCDQPVRWGV
A0A2K6GWV0_BAD-01       -SHHGGAGSVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAA
                                                                          

A0A2K6EM90_PMAIP1-      ----------------------------------ECALQLRRLGDKLHFQ
A0A2K6GE31_BCL2L11      ----------------------------------RPEIWIAQELRRIG--
A0A2K6GL98_HRK-01       ----------------------------------QRTMWRRRARSRRAPA
A0A2K6FFR1_BMF-02       VVADPPLPTQPC----------------------FERRREQERGRSQ---
A0A2K6FFR1_BMF-01       FPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRM
A0A2K6FQZ3_BBC3-04      REIGAQLRRMADDL----NAQY------------ERRRQEEQQRHRPSPW
A0A2K6FQZ3_BBC3-01      REIGAQLRRMADDL----NAQY------------ERRRQEEQQRHRPSPW
A0A2K6GE31_BCL2L11      -------------------DRS------------PAPMSCDKSTQTPSPP
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPP
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPP
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPP
A0A2K6GE31_BCL2L11      VRRSSLLSRSSSGYFSFDTDRS------------PAPMSCDKSTQTPSPP
A0A2K6FM79_BIK-01       ------LGSLSDGF--ANLREY------------VARLWRSLSPRPWVCP
A0A2K6GWV0_BAD-01       QRYGRELRRMSDEF--EDSFKK------------GLPRPKSAGTATQIRQ
                                                                          

A0A2K6EM90_PMAIP1-      QKLLNLIAKLFRSGT-----------------------------------
A0A2K6GE31_BCL2L11      -DEFNAYYPRRLAKCLVPSI------------------------------
A0A2K6GL98_HRK-01       PGALTTYWPWLCAAAQVAALAAWLLGRRNL--------------------
A0A2K6FFR1_BMF-02       --------------------------------------------------
A0A2K6FFR1_BMF-01       WWQILLFLHNLALNGEENRNGAGPR-------------------------
A0A2K6FQZ3_BBC3-04      RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
A0A2K6FQZ3_BBC3-01      RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
A0A2K6GE31_BCL2L11      CQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVF
A0A2K6GE31_BCL2L11      CQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVF
A0A2K6GE31_BCL2L11      CQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRMP
A0A2K6GE31_BCL2L11      CQAFNHYLSAM-----GIFE------------------------------
A0A2K6GE31_BCL2L11      CQAFNHYLSAMVREIEEVVV------------------------------
A0A2K6FM79_BIK-01       APAWEQVLLLLLVLLLLGGGLHLLLK------------------------
A0A2K6GWV0_BAD-01       SSSWTRVIQSWWDRNVGRGGSAPSQ-------------------------
                                                                          

A0A2K6EM90_PMAIP1-      ------------------------------
A0A2K6GE31_BCL2L11      ------------------------------
A0A2K6GL98_HRK-01       ------------------------------
A0A2K6FFR1_BMF-02       ------------------------------
A0A2K6FFR1_BMF-01       ------------------------------
A0A2K6FQZ3_BBC3-04      ------------------------------
A0A2K6FQZ3_BBC3-01      ------------------------------
A0A2K6GE31_BCL2L11      LNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      LNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      LPSD--------------------------
A0A2K6GE31_BCL2L11      ------------------------------
A0A2K6GE31_BCL2L11      ------------------------------
A0A2K6FM79_BIK-01       ------------------------------
A0A2K6GWV0_BAD-01       ------------------------------
                                                      

© 1998-2019