Dataset for protein Bmf of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FFR1_BMF-01      MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
A0A2K6FFR1_BMF-02      MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
                       **************************************************

A0A2K6FFR1_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A2K6FFR1_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
                       ***********************************************. *

A0A2K6FFR1_BMF-01      GYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A2K6FFR1_BMF-02      EPK----SHVVADPPLPTQPC----------------------FERRREQ
                         .    : . *. **  **.                      * * . *

A0A2K6FFR1_BMF-01      QHQQNQNRMWWQILLFLHNLALNGEENRNGAGPR
A0A2K6FFR1_BMF-02      ERGRSQ----------------------------
                       :. ..*                            

© 1998-2019