Dataset for protein Bim of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQ---------
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQ---------
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
A0A2K6GE31_BCL2L11      MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREG
                        *****************************************         

A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
A0A2K6GE31_BCL2L11      EGDRCSHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFD
                                                                          

A0A2K6GE31_BCL2L11      -------------------------------ASMRQFQAEPADMRPEIWI
A0A2K6GE31_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWI
A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE----------
A0A2K6GE31_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
                                                                          

A0A2K6GE31_BCL2L11      AQELRRIGDEFNAYYPRRLAKCLVPSI-----------------------
A0A2K6GE31_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      AQELRRIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
A0A2K6GE31_BCL2L11      AQELRRIGDEFNAYYPRRMPLPSD--------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
A0A2K6GE31_BCL2L11      --------------------------------------------------
                                                                          

© 1998-2018