Dataset for protein Puma of organism Propithecus coquereli

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6FQZ3_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAA
A0A2K6FQZ3_BBC3-04      ---------------------------------------MKFGAGSARAC
                                                                : *  :* *.

A0A2K6FQZ3_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2K6FQZ3_BBC3-04      PCQVPGTSFS---------------WWVLG--------HIPGPQPSLSLA
                        *. :*.: :.               .*  *        .  *********

A0A2K6FQZ3_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6FQZ3_BBC3-04      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A2K6FQZ3_BBC3-01      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
A0A2K6FQZ3_BBC3-04      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
                        *******************************************

© 1998-2018