Dataset for protein classical BH3-containing proteins of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H2NWG2_PMAIP1-01       --------------------------MPGKKARKNAQPSPARAPAEL---
A0A2J8TYJ3_BAD-01      --MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSGSSKHHRQAPGLLRDA
A0A2J8T301_BMF-01      -------MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLL-DC
H2NZD3_BBC3-01         MARARQEGSSPEPVEGLARD--GPRPFPLGRLVPSAVSCGLCEPGLA-AA
H2NIS8_HRK-01          ---------------------MCPCPLHRD-----------RGPPAV---
H2P4N6_BIK-01          --------------------MSEVRPISRDILMETLLYEQLLEPPTM---
H2P5E2_BCL2L11-01      -------------------MAKQPSDVSSECDREGRQLQPAERPPQL---
                                                                         

H2NWG2_PMAIP1-01       --------------------------------------------------
A0A2J8TYJ3_BAD-01      SHQQEQPTSSSHHGGAGAVEIRSRH--------SSYPAGTEDDEGMGEEP
A0A2J8T301_BMF-01      PLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEP
H2NZD3_BBC3-01         PAAP-ALLPAAYLCAPTAPPAV-----------TAALGGPRWPGGPRSRP
H2NIS8_HRK-01          -------------CA--------------------CSAGRLGLRSSAAQL
H2P4N6_BIK-01          -------------EVLGVTDSEEDLDPMEDFSPLECMEG--------SDA
H2P5E2_BCL2L11-01      -------------RP-GAPTSLQTEPQDRSPAPMSCDKS--------TQT
                                                                         

H2NWG2_PMAIP1-01       ------------------------------------------------EV
A0A2J8TYJ3_BAD-01      S--------------------------------PFRGRSRSAPPNLWAAQ
A0A2J8T301_BMF-01      Q---------RLFYGNAGYRLPLPASF------PAVLPTGEQPPEGQWQH
H2NZD3_BBC3-01         RGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAR
H2NIS8_HRK-01          T---------AARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLC
H2P4N6_BIK-01          L---------ALRLACIGDEMD--VSLRAPRRAQL-PEVAMHSLGLAFIY
H2P5E2_BCL2L11-01      P---------SPPCQAFNHYLSAMASMRQAEPADMRPEI--------WIA
                                                                         

H2NWG2_PMAIP1-01       ECATQLRRFGDKLNFRQKLLNLISKLFCSGT-------------------
A0A2J8TYJ3_BAD-01      RYGRELRRMS------DEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVF-
A0A2J8T301_BMF-01      RAEVQIARKL------QCIADQFHRLHVQQH------QQNRNRVWWQIL-
H2NZD3_BBC3-01         EIGAQLRRMA------DDLNAQYERRRQEEQ------QRHRPSPWRVLYN
H2NIS8_HRK-01          AAAQ-VAALAAWLLGRRNL-------------------------------
H2P4N6_BIK-01          DQTEDIRDVL------RSFTDGFTTLKEN-------IMRF-----WSSL-
H2P5E2_BCL2L11-01      QELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH-
                            :            :                               

H2NWG2_PMAIP1-01       --------------------
A0A2J8TYJ3_BAD-01      QSWWDRNLGRGSSAPSQ---
A0A2J8T301_BMF-01      LFLHNLALNGEENRNGAGPR
H2NZD3_BBC3-01         LIMGLLPLPRGHRAPEMEPN
H2NIS8_HRK-01          --------------------
H2P4N6_BIK-01          --------------------
H2P5E2_BCL2L11-01      --------------------
                                           

© 1998-2018