Dataset for protein classical BH3-containing proteins of organism Poecilia reticulata

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P9N073_BCL2L11      ----------DPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGRGEPD
A0A3P9Q7C3_BAD-01       MDAKFTISDSDSEPSEDVEE------RGNLQLMQVKER------PLSQRH
A0A3P9Q8E2_BMF-01       ----------MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALH
                                      .  .        *        .              

A0A3P9N073_BCL2L11      SDSPPCTVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPV
A0A3P9Q7C3_BAD-01       TLTLPELRSTTGRVRLNSES------------------------------
A0A3P9Q8E2_BMF-01       NGMLPCGVAEEPRRLFYGNAGFR---------------------------
                        .   *   :      : . :                              

A0A3P9N073_BCL2L11      TADKTTQTPSPTGQVMNHALQRMAVEHEIPKLNVKGKEEKGGRGGAFVII
A0A3P9Q7C3_BAD-01       ---------------------IASTISREEELQARGEEEVGTPTEGFPFR
A0A3P9Q8E2_BMF-01       -------------------LHFPAHFELVRDFDARQQEE-QNRMEQLPLH
                                               :      .::.. :**       : : 

A0A3P9N073_BCL2L11      PKRETNQPILSCVLPVQLMIQQFSHATSIGIKKRKRVGYDDD--------
A0A3P9Q7C3_BAD-01       VRSNSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRKVSSAGSN-GPIH
A0A3P9Q8E2_BMF-01       -----QPAALSLEACIGQKLQLIGDQF----HREHLQQYQQNQRNQGPL-
                               . *         :. :.        .      ..         

A0A3P9N073_BCL2L11      ----YY-------HYYIDCFFLKSVSKYDVA------
A0A3P9Q7C3_BAD-01       HSRSWW-------SYLFSHQETEGENNHHENHASRTE
A0A3P9Q8E2_BMF-01       ----WWRMTAALLSLLFDRGFIAGGGGAGRR------
                            ::          :.     . .           

© 1998-2019