Dataset for protein classical BH3-containing proteins of organism Poecilia mexicana

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3YII5_BCL2L11      MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGAS
A0A3B3YII5_BCL2L11      MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGAS
A0A3B3WU80_BMF-01       --------------MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPG
A0A3B3YFR1_BAD-01       ----MDAKFTISDSDSEPSEDVEE------RGNLQLMQVKER------PL
                                           :..        *      : :        . 

A0A3B3YII5_BCL2L11      TAGGGGGGGGGGRGEPDSDSPPCSVSPASLDVFRSRSIFRPPRRSSSGYF
A0A3B3YII5_BCL2L11      TAGGGGGGGGGGRGEPDSDSPPCSVSPASLDVFRSRSIFRPPRRSSSGYF
A0A3B3WU80_BMF-01       QA--------------------------------LHNGMLPCGVAEEPR-
A0A3B3YFR1_BAD-01       SQ--------------------------------RHTLTLPELRSTTGRV
                                                           ..   *   :     

A0A3B3YII5_BCL2L11      SFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLH
A0A3B3YII5_BCL2L11      SFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLH
A0A3B3WU80_BMF-01       RLFYGNAGFRLHFPAHFELVGDFDARQQE---------------EQNRME
A0A3B3YFR1_BAD-01       RLNSESIASTISREEELQARGEEEVGTPT---------------EGFPFR
                         :   .          .      :.                       : 

A0A3B3YII5_BCL2L11      GHSPNHYSTINAARDMQSENFGRQLRAIGDDY----NNHLMRMARRHQRN
A0A3B3YII5_BCL2L11      GHSPNHYSTINAARDMQSENFGRQLRAIGDDY----NNHLMRMARRHQRN
A0A3B3WU80_BMF-01       QLPLHQPAALSLEA-----CIGQKLQLIGDQF----HREHLQQYQQNQRN
A0A3B3YFR1_BAD-01       GRSNSAPPSLWAAK-----KYGRQLRRMSDEFVNLLDKGEMRKVSSTGSN
                          .    .::           *.:*. :.*::     .  :.       *

A0A3B3YII5_BCL2L11      IVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV---
A0A3B3YII5_BCL2L11      IVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQV---
A0A3B3WU80_BMF-01       -------Q----GPLWWRMTAALLSLLFHRGFIAGGGGAGRR------
A0A3B3YFR1_BAD-01       -------RPIHHSRSWW-------SYLFSHQETEGENNHHENHASRTE
                                                  :       *  .   .      

© 1998-2019