Dataset for protein classical BH3-containing proteins of organism Poecilia latipinna

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B3UA11_BAD-01       ---------MDAKFTISDSDSEPSEDVEERGNLQLMQVKERP--------
A0A3B3VNE0_BCL2L11      MHSSRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQTGAS
                                 :*..  :: ::.  .: ...  . .  : .**.        

A0A3B3UA11_BAD-01       -------------------------------LSQRHTLTLPELRSTTGRV
A0A3B3VNE0_BCL2L11      TAGGGGGGGGGGGGEPDADSPPCSVSPASLDVFRSRSIFRPPRRSSSGYF
                                                       : . .::  *  **::* .

A0A3B3UA11_BAD-01       RLNSESIASTISREEELQARGEEEVGTPT---------------EGFPFR
A0A3B3VNE0_BCL2L11      SFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLH
                         ::.:*:.*:      : *    :. :**                *: :.

A0A3B3UA11_BAD-01       GRSNSAPPSLWAAKK-----YGRQLRRMSDEFVNLLDKGEMRKVSSTGSN
A0A3B3VNE0_BCL2L11      GHSPNHYSTINAARDMQSETFGRQLRAIGDDYNNHLMVRRMAR-------
                        *.* .  .::.**..     :***** :.*:: * *    * .       

A0A3B3UA11_BAD-01       RPIHHSRSWWSY-LFSHQETE---------------------GENNHHEN
A0A3B3VNE0_BCL2L11      ---RHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDH
                           .*.*.  .  *:.* : *                     *:.. *::

A0A3B3UA11_BAD-01       HASRTE
A0A3B3VNE0_BCL2L11      SQV---
                              

© 1998-2019